SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 247156.nfa38870 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  247156.nfa38870
Domain Number 1 Region: 22-164
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-45
Family Ribonuclease PH domain 1-like 0.000000328
Further Details:      
 
Domain Number 2 Region: 342-514
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-44
Family Ribonuclease PH domain 1-like 0.00000151
Further Details:      
 
Domain Number 3 Region: 165-282
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.5e-26
Family Ribonuclease PH domain 2-like 0.00000584
Further Details:      
 
Domain Number 4 Region: 496-600
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.78e-23
Family Ribonuclease PH domain 2-like 0.0000175
Further Details:      
 
Domain Number 5 Region: 286-367
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.14e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00016
Further Details:      
 
Domain Number 6 Region: 609-695
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.04e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 7 Region: 676-744
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000567
Family Cold shock DNA-binding domain-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 247156.nfa38870
Sequence length 764
Comment (Nocardia farcinica IFM10152)
Sequence
MTQTSERKSSAVEVEPGVFESVALIDNGSYGTRTVRFETGRLARQAAGSVVAYLDDETML
LSATTAGKTPKDQFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTDAILTCRLIDRPLR
PSFVDGLRNEVQVVVTVLSLDPKDLYDVVAINAASASTQIAGLPFSGPVGGVRVALIPDQ
GANSAGGGQWVAFPTVEQLEGAVFDMVVAGRVVESGDVAIMMVEAEATEKVIELVEGGAQ
APTEAVVAEGLEAAKPFIARLCRAQQDLAELAAKPTEEFPLFPPYGPDVYEAVEGAAEAE
LGEALSIAGKQEREEKIDEIKLAVLDRLAEQFAGREKELGAAFRSVTKKLVRQRILTDGF
RIDGRGLADIRALSAEVAVVPRAHGSALFERGETQILGVTTLDMVKMAQQVDSLGPETSK
RYMHHYNFPPFSTGETGRVGSPKRREIGHGALAERALIPVLPSQEDFPYAIRQVSEALGS
NGSTSMGSVCASTLSLLNAGVPLKAPVAGIAMGLVSDTVTNDKGEQEVRYVALTDILGAE
DAFGDMDFKVAGTREFVTALQLDTKLDGIPSQVLAGALSQAHDARTTILDVMAEAIATPD
EMSPYAPRVTAIKIPVDKIGEVIGPKGKVINQITEDTGANISIEDDGTVFVGATDGPSAQ
AAIDAINAIANPQLPKVGERFLGTVVKTTAFGAFVSLLPGRDGLVHISKLGNGKRVAKVE
DVVNVGDKLRVEIADIDNRGKISLVPVDENADEPAADAVDAGTE
Download sequence
Identical sequences A0A0H5NCW8 A0A2A7UEZ5 Q5YSV6
WP_011210420.1.31130 WP_011210420.1.72093 WP_011210420.1.78782 WP_011210420.1.85486 WP_011210420.1.97239 247156.nfa38870 gi|54025857|ref|YP_120099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]