SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 247156.nfa3890 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  247156.nfa3890
Domain Number 1 Region: 4-182
Classification Level Classification E-value
Superfamily PRTase-like 4.98e-51
Family Phosphoribosyltransferases (PRTases) 0.00000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 247156.nfa3890
Sequence length 185
Comment (Nocardia farcinica IFM10152)
Sequence
MYGDDIASVLITEEQIAAKTKELAELIAKRYPAGAPEGDLLLVGVLKGAIFFMTDLAKAL
PIPTQMEFMAVSSYGSSTSSSGVVRIMKDLDKDIAGRNVLIVEDIIDSGLTLSWLKRNLS
TRNPASLEVVTLLRKPDALRTQVEVAHVGFDIPNEFVVGYGLDYAERYRDLPYIGTLDPK
VYGGA
Download sequence
Identical sequences A0A0H5NZC1 A0A2A7UK23 Q5Z2W0
WP_011206918.1.31130 WP_011206918.1.72093 WP_011206918.1.78782 WP_011206918.1.85486 WP_011206918.1.97239 gi|54022353|ref|YP_116595.1| 247156.nfa3890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]