SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 247156.nfa9650 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  247156.nfa9650
Domain Number 1 Region: 3-77,178-263
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.71e-29
Family Bacterial dinuclear zinc exopeptidases 0.0029
Further Details:      
 
Domain Number 2 Region: 63-179
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.02e-19
Family Bacterial exopeptidase dimerisation domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 247156.nfa9650
Sequence length 267
Comment (Nocardia farcinica IFM10152)
Sequence
MPELPVGVRLIFQPAEEVMPGGALDMVAAGALDGIERIFAVHCDPRLEVGRVGMRVGAIT
SAADTVELVLDSPGGHTSRPHLTSDLVYAIGTVITGLPGLLSRRIDPRTSTVMVWGAVSA
GKAPNAIPQTGMLTGTVRTGDHATWSLLEPMVHEIVDGLLAPTGVRYQLNYRRGVPPVVN
DEHSARQFEDAIRALGPDALSDTPQSGGGEDFSWYLEEVPGAMARLGVWSGHGEQLDLHQ
PTFDIDERALAVGVRVFTNLVLQQRPR
Download sequence
Identical sequences Q5Z181
gi|54022932|ref|YP_117174.1| 247156.nfa9650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]