SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.gll0601 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  251221.gll0601
Domain Number - Region: 29-141
Classification Level Classification E-value
Superfamily SET domain 0.0229
Family RuBisCo LSMT catalytic domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 251221.gll0601
Sequence length 238
Comment (Gloeobacter violaceus)
Sequence
MIRFLVSILVFVIDVLYKNRPYPRFYVLETVARVPYFSYLSVLHLYETLGLWRKSDWLKV
HFAETWNELHHLLIMESLGGNDRWYDRLLAKSSALVYYWVIVVLYMISPRSAYEFMRQVE
EHAFHTYDEFLKSDGERLKLQPAPVVAVSYYLTGDLYMFDEFQTSRRPEERRPACDTLYD
VFVNIRDDEAEHVKTMAACKAENAQLTFKSPHSALPEAKSEPPIAAPQPRATGRGALE
Download sequence
Identical sequences Q7NN13
251221.gll0601 gi|37520170|ref|NP_923547.1| NP_923547.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]