SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.gll0844 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gll0844
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily PIN domain-like 2.05e-31
Family PIN domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 251221.gll0844
Sequence length 135
Comment (Gloeobacter violaceus)
Sequence
MTFVYLLDTCTVSDFAKAQPGVIARIKSTAPTLVSISSITVMEIECGLQFNPKRAEKVAP
VLAAFVDSVQILPLSLEDARAAGAIRAGLTKQGRPIGAYDVLLAGCAVCRGLIFVTSNTT
EFERVGGLRLENWRS
Download sequence
Identical sequences Q7NMC2
gi|37520413|ref|NP_923790.1| 251221.gll0844 NP_923790.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]