SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.gll2861 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gll2861
Domain Number 1 Region: 56-172
Classification Level Classification E-value
Superfamily Ferritin-like 0.0000257
Family Ferritin 0.052
Further Details:      
 
Weak hits

Sequence:  251221.gll2861
Domain Number - Region: 158-207
Classification Level Classification E-value
Superfamily t-snare proteins 0.0149
Family t-snare proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 251221.gll2861
Sequence length 228
Comment (Gloeobacter violaceus)
Sequence
MVKRLLIAGLTGYFYGRAAADARQRVNVFASLALQEAEGGRTLERIRQAKAAEIPAWLDE
LMQRHIRDEERHAVIFRRAVAAEKMSIDAESPAAVQASASVGEGSIKRFHKSEDLAAIAL
TDLLAGILIAEEGGVRAFRSLIRTIPVQLSKTRAGLESVLADEERHVRYLTDTLRTLGAS
RNAERMRRRIENQVFDDFGKIVEHLLSRKERPVLVKAGVDTEVAGEAL
Download sequence
Identical sequences Q7NCW5
251221.gll2861 gi|37522430|ref|NP_925807.1| NP_925807.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]