SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.gll3149 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gll3149
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-48
Family Ribonuclease PH domain 1-like 0.0000146
Further Details:      
 
Domain Number 2 Region: 301-496
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.77e-47
Family Ribonuclease PH domain 1-like 0.0000108
Further Details:      
 
Domain Number 3 Region: 144-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-27
Family Ribonuclease PH domain 2-like 0.0017
Further Details:      
 
Domain Number 4 Region: 459-557
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.31e-26
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 5 Region: 564-649
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.11e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 6 Region: 620-702
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.62e-18
Family Cold shock DNA-binding domain-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 251221.gll3149
Sequence length 713
Comment (Gloeobacter violaceus)
Sequence
MIEYRKSVTVHGREIGLSTGVLAQLAGGSVLVQSGETAVLVTATMASKPREGIDFFPLLV
DYEERLYAAGRIPGSFVRREGRPPEKAILAARLIDRPLRPLFPKGFINDVQIVATVLALD
MNVPPDILAILGASTATMLAGIPFDGPVAATRVGLMGDDFIINPTYKEIEEGELDLVVAG
TKNGIMMVEAGANCLPEEDIIDAIDYGYEAVQAMLTAQEEFIRDLKIEPMAFVAPANDPV
LVSFVEEKASEAVAEVLRSFELSKDERDAKLDAIEAELGTTFAGLGEEDPLREKAAANAS
KLPALFKSTTKKLMRKQILVEGKRVDGRSLDEVRPISSAVRVIPRVHGCGLFTRGTTQVL
SVVTLGTASDAQELDDLHPDDSKRYMHHYNFPGFSVGEVKPLRGVGRREVGHGALAERAI
VPILPEHEQFPYVIRVVSEVLSSNGSTSMGSVCASTLALMDAGVPIREPVSGVAMGLIKE
GDEVRILTDIQGIEDFLGDMDFKVAGTRDGITALQMDIKIQGITLQILEAAIQQSKAGRL
HILEKMLIAIDKPRVELSPYAPRLLTLKIPVDMIGLVIGPGGKTIKRIVEETGAKVDIED
DGTVVVSSIDGAKALAAKQIIEGMTRTVEVDKVYLGTVTRIIPNLGAFVEVMPGKEGLVH
ISQLAEHRVRKVEDELNVGDEVVVKVKEIDQKGRINLTRRGIHPSEVEEARGQ
Download sequence
Identical sequences Q7NGM0
NP_926095.1.44878 gi|37522718|ref|NP_926095.1| 251221.gll3149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]