SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.glr0462 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  251221.glr0462
Domain Number - Region: 451-575
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00871
Family Beta-D-xylosidase C-terminal domain-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 251221.glr0462
Sequence length 640
Comment (Gloeobacter violaceus)
Sequence
MRMLIRNRCRYLVAVRMSVLTAGLLALATLVSSPAAKASGKLSVRTPDSEIVNNRVVFST
VDEEIRSPKSVTLTNSGLEPLTISSLVLGDSDEIVNAANGRSGDYKRAGDFQILNAPALP
LVLAPNASLELSIQFAPQRGSGIIQNSSTHSTNAENYATLSVSTDDPAQPIFKIPLAGLN
AVGYEGNNEPAAAEISRSFGWSTVIGTELLKIGGDKALVGEELYSPYWVRADASKPLLAW
PLARYAARKTGLQGYTKLRPKSGGTDNQILVFEGGSDESGGENQRLLPKISVDGTDVAPT
AGTIGRFPNGPFGIKLDNAYINDAQNTPDQPHNWRIFPVRDKNGALVPNHWYGIVDPGNK
NPTPESGKNYDYQDGVFLLANVRPESASLNPATPGLTPGNSALILFFRSAVSGTLTDVNG
AGLGFTSTQRNNNDTFTSTPSYNAGLLRLSTANTGTLVLTTADSSPSRTDNNLVNGLQLA
FDGRSVPFTASAKILGPLSQIAVPPYQQAGIFTGPDQDNFIKLVARATDTNTIGIEFYQE
RRAVGTTISTVSLANPSTLQSLELYLTADPNGSTIRSAYRAVYADLDTGVVNLPGTVTLA
GGDKGRYFDLQSKAGIMAYSKDSPSIQIVYDNFQVLKANP
Download sequence
Identical sequences Q7NNE9
251221.glr0462 gi|37520031|ref|NP_923408.1| NP_923408.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]