SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.gsl2854 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gsl2854
Domain Number 1 Region: 13-82
Classification Level Classification E-value
Superfamily ACP-like 0.000000000115
Family Acyl-carrier protein (ACP) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 251221.gsl2854
Sequence length 87
Comment (Gloeobacter violaceus)
Sequence
MSFEDMLFALGQMKIATQGLTPSSKLGKDVGMDSLELVDLQCILEKMYGLDIPSRVFEED
LCLGNVVEQVNAQLNGSTKSQAPLAKR
Download sequence
Identical sequences Q7NCX2
251221.gsl2854 NP_925800.1.44878 gi|37522423|ref|NP_925800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]