SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 257309.DIP0330 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  257309.DIP0330
Domain Number 1 Region: 301-409,455-684
Classification Level Classification E-value
Superfamily Sialidases 3.08e-90
Family Sialidases (neuraminidases) 0.0000117
Further Details:      
 
Domain Number 2 Region: 141-295
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000931
Family Trypanosoma sialidase, C-terminal domain 0.086
Further Details:      
 
Weak hits

Sequence:  257309.DIP0330
Domain Number - Region: 33-110
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00623
Family Laminin G-like module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 257309.DIP0330
Sequence length 687
Comment (Corynebacterium diphtheriae)
Sequence
MTNTLESNPMTTTTGALTITFATTCDGPLAHIPHHLDLNIIHGRIQGTTAHRRIDAEDPD
GLDDGLPHHLCLSVDTTGTHLFIDGYEAFSTTQTEWFDTSELTLNPHGDLTIIDHQILNH
APTPRQARNLAPAAEPLVWFAGSHLSTRDTQRISHLTHGSLRLLMKTRGTGQGGVAFQAH
TINGDLTLEIIDGTLIFSVRCHDEDYVRITAPGRWDDGHIYDVVIVCGRGATDIYVDGQQ
LIHSPGAAFFNDLSGELSVHIGTSASGVRLFGEVQSGMIYPHVFNHHQVQRLATVEPIAT
QALFDCLLDGAQSYRIPSLITTDSGVIIAGADKRVSIANDAPNDIDFVLRRSVDGGRTWQ
PPRTILQLPDTACVTDSVLLQDHTTGRIFAFLDQFPAGIGQPNAAFGTGFDADGNRIGHF
ADGSTCTMPREVDQLEASFFSDPHTAPPGIVFQHPSCHLWMLTSDDDGLSWSTPRDLTPD
VKEEWMRFCGTSPGNGIQLQRGTHAGRLLIPMYYTKGDQFFAAALYSDDHGDTWHRGESP
DLEMYESTLVEASDGSVLLWARNQHPSGAVAHARSTDGGHSWSQVTFNPNVPEIFSQPNA
LRVTNPDGIIFANASQLLPFRGRGVLRMSTNDGASWQHNRVFNPRHYVYQCMTQLPDGSI
GLLWEREMQGLFFSIIPMTWIMQGYAL
Download sequence
Identical sequences Q6NJR3
257309.DIP0330 gi|38232951|ref|NP_938718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]