SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 257309.DIP1467 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  257309.DIP1467
Domain Number 1 Region: 24-164
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.96e-47
Family Ribonuclease PH domain 1-like 0.00000072
Further Details:      
 
Domain Number 2 Region: 348-546
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-43
Family Ribonuclease PH domain 1-like 0.00000101
Further Details:      
 
Domain Number 3 Region: 505-604
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.7e-23
Family Ribonuclease PH domain 2-like 0.0000196
Further Details:      
 
Domain Number 4 Region: 166-286
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.66e-22
Family Ribonuclease PH domain 2-like 0.0000119
Further Details:      
 
Domain Number 5 Region: 613-699
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.01e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 6 Region: 678-748
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000164
Family Cold shock DNA-binding domain-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 257309.DIP1467
Sequence length 755
Comment (Corynebacterium diphtheriae)
Sequence
MSTKPSNVVFNIDEEFGITEAIATIDNGDFGKRTIRFETGQLARQADGSVTTYLDDDTML
LATTTASNQPREGFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTEAILACRLIDRPLR
PTFVKGLRNEVQVVITVLSVNPQDMYDVVAINGASAATQLSGLPVSGPVGGVRMALIADD
AHPKGQWIAFPTHEQHEQALFELVVAGRIVSKKQGKKTVDDVAIMMVEAGATEQVVDRVK
AGAPAPTESVVAEGLEAAKPFIEVLCRAQAGLAERAAKETQEFPLFPPYTDVVYDAVEKK
VSKKLRSLLTIKSKQDRDEATNAYMEEIEADLIAQLGSDDEAAASKAIRAAYNAVMKKIV
RHMILTEHFRIDGRGVTDIRDLGVEVDLIPRAHGSSLFERGETQILGVTTLDMLKMEQQI
DSLTPATSKRYIHHYNFPPYSTGETGRVGSPKRREIGHGALAERALVPVIPSREEFPYAI
RQVSEALGSNGSTSMGSVCASTLSLYNAGVPLKAPVAGIAMGLVSDEVDGETRYVALTDI
LGAEDAFGDMDFKVAGTRQFITALQLDTKLDGIPSEVLAQALSQANDARNTILDTMAEVI
ETPDEMSDYAPRITAITVPVNKIGEVIGPKGKTINSITEETGANISIEEDGTVYVSAASG
AAAEAAIEKINAIANPQLPKVGERFLGTVVKTTAFGAFVSLLPGRDGLVHISKLGGGKRI
EKVEDVVNVGDKLEVEILDIDNRGKISLAPVKNED
Download sequence
Identical sequences A0A0F5D9S1 Q6NGP1
gi|38234048|ref|NP_939815.1| WP_010935086.1.11186 WP_010935086.1.12056 WP_010935086.1.13923 WP_010935086.1.14799 WP_010935086.1.15382 WP_010935086.1.16169 WP_010935086.1.20047 WP_010935086.1.21235 WP_010935086.1.22617 WP_010935086.1.2359 WP_010935086.1.24021 WP_010935086.1.24410 WP_010935086.1.24452 WP_010935086.1.24530 WP_010935086.1.26788 WP_010935086.1.2787 WP_010935086.1.31012 WP_010935086.1.31738 WP_010935086.1.33967 WP_010935086.1.34071 WP_010935086.1.35664 WP_010935086.1.36771 WP_010935086.1.39547 WP_010935086.1.41054 WP_010935086.1.41144 WP_010935086.1.42841 WP_010935086.1.43515 WP_010935086.1.43592 WP_010935086.1.4375 WP_010935086.1.44089 WP_010935086.1.4494 WP_010935086.1.45526 WP_010935086.1.47154 WP_010935086.1.51796 WP_010935086.1.52799 WP_010935086.1.52928 WP_010935086.1.5502 WP_010935086.1.56727 WP_010935086.1.580 WP_010935086.1.58917 WP_010935086.1.60254 WP_010935086.1.65864 WP_010935086.1.67038 WP_010935086.1.67504 WP_010935086.1.67527 WP_010935086.1.68611 WP_010935086.1.69403 WP_010935086.1.70634 WP_010935086.1.71515 WP_010935086.1.73245 WP_010935086.1.73495 WP_010935086.1.73977 WP_010935086.1.7622 WP_010935086.1.77064 WP_010935086.1.80770 WP_010935086.1.816 WP_010935086.1.82314 WP_010935086.1.82318 WP_010935086.1.85853 WP_010935086.1.86054 WP_010935086.1.86272 WP_010935086.1.91366 WP_010935086.1.92257 WP_010935086.1.92337 WP_010935086.1.93248 WP_010935086.1.94633 WP_010935086.1.95894 WP_010935086.1.96122 WP_010935086.1.97188 WP_010935086.1.98240 WP_010935086.1.98565 257309.DIP1467 gi|376257366|ref|YP_005145257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]