SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 257310.BB2694 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  257310.BB2694
Domain Number 1 Region: 74-264
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000155
Family Laminin G-like module 0.073
Further Details:      
 
Weak hits

Sequence:  257310.BB2694
Domain Number - Region: 458-548,659-675
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.00298
Family A4 beta-galactosidase middle domain 0.077
Further Details:      
 
Domain Number - Region: 277-435
Classification Level Classification E-value
Superfamily YerB-like 0.068
Family YerB-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 257310.BB2694
Sequence length 746
Comment (Bordetella bronchiseptica)
Sequence
MYEILGYPSTWTVAPGETIEFKVSCARALRYDADLVRIRSGDVSPGAPGLKETVALAGIA
RGVQGRPQHTETGSRAVAPPFAEPARGARSWVLAIMPTLPQSGHEQIILARHDGAAGTGY
ALGLDKAGCLFWEQAQAGKARRLTLARAVVARQWYLVAVGIDADSGEVTLRQVPANPLLA
ANSHDQASVRWSPLPAGATDALPVVFGARPSGGRAPAYLHHYNGRIDSPTLLPCRAGDAD
LAQLRVEAARRRHGAPPLAAWDFGLRIDSDVIVNTAIPWAEGRIENLPARAVPGLRWDAS
IMRWQDGPDHYGALHFHDDTLEDANWDTDFSLEIPANLPSGLYAARLTGAQGEQERITFV
VRPRAGAPRKRIAFLASTATYMAYSNSHYRLDEEGMEMKSGNFMVLYPWETYLGEHRELG
LSMYDTHSDGYGVYYATRRRPVFSMHLQCRTWSLNGDTHFLDWLDEKGFEYDVITDDMLH
AEGLAALQGYRAVMTGAHPEYWSTRMWQAMVAYQAQGGRLMYMGGNGFYWRCAYHPEKPW
LMELRRTETGARYSETPAGESYHSYNGEYGGTWRRIGIAPQTLVGIGTTATGFDASSYYR
RRPESHDPRVAFMFDGVSEEIIGDFGSSGGGAAGDEIDRADFRLGTPPHALIVARSEKHT
RYYNVVPEETTYHHPTINGEEAKYCYADLLFYECLNGGAVFSTGSITWGASLAWNGYDNN
VSRITANVLSRFAHDTPFDFPTTPQA
Download sequence
Identical sequences A0A0H3LVY3
257310.BB2694 WP_010926598.1.15674 WP_010926598.1.17334 WP_010926598.1.27032 WP_010926598.1.29688 WP_010926598.1.40806 WP_010926598.1.50287 WP_010926598.1.63717 WP_010926598.1.69310 WP_010926598.1.71104 WP_010926598.1.71382 WP_010926598.1.72302 WP_010926598.1.78117 WP_010926598.1.82663 WP_010926598.1.84976 WP_010926598.1.86585 WP_010926598.1.87218 gi|33601671|ref|NP_889231.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]