SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 257310.BB3526 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  257310.BB3526
Domain Number - Region: 101-132
Classification Level Classification E-value
Superfamily Prefoldin 0.0602
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 257310.BB3526
Sequence length 139
Comment (Bordetella bronchiseptica)
Sequence
MFAVIETNNASHIAIHIPKEGADKSLPALAAMLEHNATFINKGWREINVVKPSMHIILGD
KFDTESDDAGELLIQACADVVSDDFVIATPEVFVSNKTAIAKKQEEIDRLRSELQSVRFQ
LDAANARITELQAPDCEEA
Download sequence
Identical sequences A0A0H3LVP7 A0A1M9NMD9
WP_010926837.1.14246 WP_010926837.1.15674 WP_010926837.1.67928 WP_010926837.1.71104 WP_010926837.1.82663 gi|33602501|ref|NP_890061.1| 257310.BB3526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]