SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 257311.BPP0201 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  257311.BPP0201
Domain Number 1 Region: 13-202
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.23e-41
Family Methenyltetrahydrofolate synthetase 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 257311.BPP0201
Sequence length 226
Comment (Bordetella parapertussis)
Sequence
MHTQNTAKNTAAALRARLRQSRAELTSSQRSRGALLMRGRLFTWLNLACEQAAAQGRPLS
RVAAFWPMEDEPDLLPLLEQWVESGIAVCLPAVQERDAPLVFRDWTPDSAMRTGAYGIQE
PAAGPAVVPDVVLVPTLGYTLDAARLGYGGGYYDRTLAAWQAADASPTTIGIAWSEGLLP
DDYQAAAHDIALDAILTPDGWVPGAPLVASGAAAGHRSAGSRFLLR
Download sequence
Identical sequences A0A2J9U3W5 Q7W1Z1
WP_010927342.1.23657 WP_010927342.1.26498 257311.BPP0201 gi|33594919|ref|NP_882562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]