SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 257311.BPP0634 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  257311.BPP0634
Domain Number - Region: 93-151
Classification Level Classification E-value
Superfamily ACT-like 0.0124
Family Atu0741-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 257311.BPP0634
Sequence length 160
Comment (Bordetella parapertussis)
Sequence
MPSPTIRIEGEHAMAHDPIEVWKKMPMKVWPERYWLIDVPAEHGEAVARALAHSQSRYVA
VIRDQTGFSLVVDEQTWEGHGSAQAERQKFGPLKVISTDGPLPFDVTGFIKAALEPVNTL
GMKAAPQCGAAADHFFCAEAEVDQVAAVFERFTAGFGAAR
Download sequence
Identical sequences Q7WBQ2
257311.BPP0634 gi|33595335|ref|NP_882978.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]