SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 257311.BPP1486 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  257311.BPP1486
Domain Number - Region: 97-131
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.00131
Family Phase 1 flagellin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 257311.BPP1486
Sequence length 139
Comment (Bordetella parapertussis)
Sequence
MSLLSIFEIAGSALSAQSQRMNVSASNMANADSVAGPDGQPYRARQVVFQVNPPPGQAFG
QEIGGVRVAGVVEDQSPFKKIYDPKHPMADAQGYVNMPNVDPVAETVNMIAASRSYQANV
EVLNTAKQLMLKTLTIGQS
Download sequence
Identical sequences A0A0C6NZU8 A0A0H3LMI4 A0A1M9MXW1 A0A2J9U0M1 Q7WA96
gi|412337708|ref|YP_006966463.1| WP_003811891.1.14246 WP_003811891.1.15674 WP_003811891.1.1660 WP_003811891.1.17334 WP_003811891.1.17359 WP_003811891.1.19828 WP_003811891.1.20111 WP_003811891.1.21837 WP_003811891.1.23657 WP_003811891.1.24339 WP_003811891.1.26498 WP_003811891.1.27032 WP_003811891.1.29688 WP_003811891.1.30681 WP_003811891.1.32589 WP_003811891.1.37794 WP_003811891.1.38534 WP_003811891.1.40806 WP_003811891.1.50287 WP_003811891.1.54628 WP_003811891.1.57255 WP_003811891.1.58338 WP_003811891.1.63299 WP_003811891.1.63717 WP_003811891.1.64622 WP_003811891.1.66177 WP_003811891.1.69310 WP_003811891.1.71104 WP_003811891.1.71382 WP_003811891.1.71489 WP_003811891.1.72041 WP_003811891.1.72199 WP_003811891.1.72302 WP_003811891.1.78117 WP_003811891.1.82663 WP_003811891.1.84958 WP_003811891.1.84976 WP_003811891.1.86585 WP_003811891.1.87218 WP_003811891.1.88542 WP_003811891.1.91389 WP_003811891.1.93987 YP_006966463.1.84680 gi|33601539|ref|NP_889099.1| NYSGRC-SEC-33596138 gi|33596138|ref|NP_883781.1| 257310.BB2560 257311.BPP1486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]