SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 257311.BPP4150 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  257311.BPP4150
Domain Number 1 Region: 131-279
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.08e-32
Family DsbC/DsbG C-terminal domain-like 0.0011
Further Details:      
 
Weak hits

Sequence:  257311.BPP4150
Domain Number - Region: 85-132
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.000235
Family DsbC/DsbG N-terminal domain-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 257311.BPP4150
Sequence length 279
Comment (Bordetella parapertussis)
Sequence
MSGPPFSGAGMNFRITVWCAAAAVWSSGALAQDGAGQAAPGTPDKVYSTTGTAPAKPGDK
VYSTRSAQAPDPQADAVKERFAQRFEGFDVTAVRRTPYGLFEVQIGTDLLYTDEKVTWVM
EGPLIDALTRRDVTRERQEKLSSVPFDELPLDLAVKQVKGDGSRVMAVFEDPNCGYCKQL
HRTLEDMDNITVYTFLYPILSPDSTTKVRDIWCASDPAKVWKDWMVRGQRPPTAECDAPV
EQWLALGRQLMVRGTPAIFFKSGGRVSGALPRDELEARL
Download sequence
Identical sequences A0A2J9U536 K0MB65 Q7W396 Q7WEL4
257310.BB4620 257311.BPP4150 WP_003815375.1.14246 WP_003815375.1.15674 WP_003815375.1.1660 WP_003815375.1.17334 WP_003815375.1.17359 WP_003815375.1.21837 WP_003815375.1.23657 WP_003815375.1.24339 WP_003815375.1.26498 WP_003815375.1.27032 WP_003815375.1.32589 WP_003815375.1.38534 WP_003815375.1.40806 WP_003815375.1.50287 WP_003815375.1.63299 WP_003815375.1.63717 WP_003815375.1.64622 WP_003815375.1.66177 WP_003815375.1.69310 WP_003815375.1.71104 WP_003815375.1.71382 WP_003815375.1.72041 WP_003815375.1.78117 WP_003815375.1.82663 WP_003815375.1.84976 WP_003815375.1.86585 WP_003815375.1.87218 WP_003815375.1.88542 YP_006897949.1.34978 gi|33603592|ref|NP_891152.1| gi|33598640|ref|NP_886283.1| gi|410474668|ref|YP_006897949.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]