SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 257313.BP0795 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  257313.BP0795
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-52
Family Ribonuclease PH domain 1-like 0.000018
Further Details:      
 
Domain Number 2 Region: 300-493
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.57e-49
Family Ribonuclease PH domain 1-like 0.0000178
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.1e-30
Family Ribonuclease PH domain 2-like 0.00073
Further Details:      
 
Domain Number 4 Region: 455-553
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.39e-27
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 5 Region: 560-644
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.63e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 6 Region: 618-696
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.79e-18
Family Cold shock DNA-binding domain-like 0.00044
Further Details:      
 
Domain Number 7 Region: 239-326
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 8.11e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 257313.BP0795
Sequence length 719
Comment (Bordetella pertussis)
Sequence
MFNKVTKTFQYGQHSVVLETGEMARQASGAVLVSVEDTVVLATVVAAKKAKAGQDFFPLT
VDYIEKTYAAGRIPGGFFKREGKPSEKETLTSRLIDRPLRPLFPEGFYNDVQVVIHTLSV
NPDIDPDIPAMIGASAALAISGIPFNGPIGAARVGYVDGQYVLNPTATQLKSSKMDLVVA
GTENAVLMVESEAKQLSEEIMLGGVVFGHEQMQAAINAIHDLVRDAGKPDWDWQPAPKNE
ALIAAVSAAAQEGLNAAYQIREKQARTTKLREVYAAVQAAMAEQAAQAGQPAPDSVGVDN
ILFDLEARIVRSQILNGEPRIDGRDTRTVRPISIRLGVLPRAHGSALFTRGETQALVVAT
LGTKQDEQIIDALMGEYRDRFMLHYNMPPFATGETGRIGVPKRREIGHGRLAKRALLPLL
PAPEDFQYTIRLVSEITESNGSSSMASVCGGSLAMMDAGVPTNDHVAGVAMGLILDSGKF
AVLTDILGDEDHLGDMDFKVAGTETGITALQMDIKIQGITKEIMQVALAQAREGRLHILG
KMRDALEGSRTELSAFAPRMLTIKINPEKIRDVIGKGGATIRALTEETGTQIDISDDGTI
VIASVDETQAKEAQRRIVELTADVEVGQIYDGSVLRLLDFGAIVQVLPGRDGLLHISEIA
NYRIANINDVLKVGQPVRVKVIEADDKGRLRLSIKAIGGIEQQQSGTAEPAAQSEPQAE
Download sequence
Identical sequences A0A063USK2 A0A0A0XJK5 A0A0C6PCR4 A0A0E8CDB2 A0A0N2IJD3 A0A0T7CQZ3 A0A171JZN6 A0A1M9AQE0 A0A2J9U715 K0M9U0 Q7VZU0 Q7W570
gi|408416352|ref|YP_006627059.1| gi|33597949|ref|NP_885592.1| gi|412341810|ref|YP_006970565.1| NP_879610.1.91861 WP_003821234.1.100022 WP_003821234.1.100434 WP_003821234.1.100555 WP_003821234.1.100619 WP_003821234.1.100675 WP_003821234.1.100759 WP_003821234.1.100989 WP_003821234.1.101082 WP_003821234.1.101128 WP_003821234.1.101132 WP_003821234.1.10115 WP_003821234.1.101264 WP_003821234.1.101372 WP_003821234.1.101424 WP_003821234.1.10149 WP_003821234.1.101703 WP_003821234.1.10189 WP_003821234.1.101955 WP_003821234.1.10527 WP_003821234.1.10899 WP_003821234.1.11100 WP_003821234.1.11718 WP_003821234.1.12242 WP_003821234.1.12615 WP_003821234.1.12628 WP_003821234.1.12642 WP_003821234.1.12812 WP_003821234.1.12848 WP_003821234.1.12960 WP_003821234.1.12961 WP_003821234.1.12998 WP_003821234.1.13010 WP_003821234.1.13337 WP_003821234.1.13387 WP_003821234.1.13571 WP_003821234.1.13878 WP_003821234.1.13976 WP_003821234.1.1435 WP_003821234.1.14857 WP_003821234.1.14969 WP_003821234.1.15153 WP_003821234.1.15298 WP_003821234.1.15595 WP_003821234.1.15680 WP_003821234.1.15694 WP_003821234.1.16132 WP_003821234.1.16456 WP_003821234.1.16646 WP_003821234.1.16872 WP_003821234.1.16901 WP_003821234.1.16953 WP_003821234.1.17083 WP_003821234.1.1750 WP_003821234.1.17872 WP_003821234.1.18020 WP_003821234.1.18291 WP_003821234.1.18525 WP_003821234.1.18595 WP_003821234.1.18642 WP_003821234.1.18982 WP_003821234.1.19155 WP_003821234.1.19208 WP_003821234.1.19242 WP_003821234.1.19511 WP_003821234.1.19550 WP_003821234.1.19657 WP_003821234.1.19676 WP_003821234.1.19828 WP_003821234.1.20036 WP_003821234.1.20111 WP_003821234.1.20365 WP_003821234.1.20392 WP_003821234.1.20462 WP_003821234.1.20642 WP_003821234.1.20675 WP_003821234.1.20734 WP_003821234.1.20770 WP_003821234.1.20917 WP_003821234.1.2111 WP_003821234.1.21238 WP_003821234.1.21550 WP_003821234.1.2161 WP_003821234.1.21624 WP_003821234.1.21837 WP_003821234.1.21880 WP_003821234.1.21917 WP_003821234.1.22017 WP_003821234.1.22232 WP_003821234.1.22312 WP_003821234.1.22423 WP_003821234.1.22487 WP_003821234.1.22593 WP_003821234.1.22705 WP_003821234.1.22732 WP_003821234.1.23079 WP_003821234.1.23183 WP_003821234.1.23214 WP_003821234.1.23368 WP_003821234.1.23599 WP_003821234.1.23657 WP_003821234.1.23701 WP_003821234.1.2372 WP_003821234.1.23851 WP_003821234.1.23951 WP_003821234.1.24160 WP_003821234.1.24171 WP_003821234.1.24320 WP_003821234.1.24339 WP_003821234.1.24505 WP_003821234.1.24682 WP_003821234.1.24749 WP_003821234.1.24761 WP_003821234.1.24819 WP_003821234.1.24942 WP_003821234.1.25162 WP_003821234.1.25335 WP_003821234.1.25395 WP_003821234.1.25725 WP_003821234.1.25784 WP_003821234.1.25806 WP_003821234.1.25823 WP_003821234.1.26275 WP_003821234.1.26498 WP_003821234.1.26501 WP_003821234.1.26519 WP_003821234.1.26991 WP_003821234.1.27032 WP_003821234.1.27198 WP_003821234.1.27788 WP_003821234.1.28030 WP_003821234.1.28495 WP_003821234.1.28615 WP_003821234.1.28748 WP_003821234.1.2876 WP_003821234.1.2883 WP_003821234.1.28911 WP_003821234.1.2925 WP_003821234.1.29446 WP_003821234.1.29460 WP_003821234.1.29496 WP_003821234.1.29534 WP_003821234.1.29639 WP_003821234.1.29721 WP_003821234.1.30048 WP_003821234.1.30085 WP_003821234.1.3025 WP_003821234.1.30325 WP_003821234.1.30681 WP_003821234.1.30804 WP_003821234.1.31246 WP_003821234.1.3146 WP_003821234.1.31517 WP_003821234.1.31632 WP_003821234.1.31640 WP_003821234.1.31875 WP_003821234.1.31881 WP_003821234.1.32044 WP_003821234.1.3209 WP_003821234.1.32390 WP_003821234.1.32490 WP_003821234.1.32589 WP_003821234.1.32619 WP_003821234.1.32640 WP_003821234.1.32662 WP_003821234.1.32673 WP_003821234.1.32732 WP_003821234.1.32787 WP_003821234.1.3326 WP_003821234.1.33272 WP_003821234.1.33320 WP_003821234.1.33342 WP_003821234.1.33489 WP_003821234.1.33785 WP_003821234.1.33898 WP_003821234.1.33904 WP_003821234.1.33992 WP_003821234.1.34216 WP_003821234.1.34487 WP_003821234.1.3449 WP_003821234.1.34660 WP_003821234.1.34761 WP_003821234.1.34880 WP_003821234.1.34936 WP_003821234.1.35228 WP_003821234.1.35282 WP_003821234.1.35457 WP_003821234.1.35734 WP_003821234.1.35819 WP_003821234.1.35894 WP_003821234.1.36280 WP_003821234.1.36572 WP_003821234.1.37410 WP_003821234.1.37431 WP_003821234.1.37631 WP_003821234.1.37705 WP_003821234.1.37780 WP_003821234.1.37794 WP_003821234.1.3800 WP_003821234.1.38046 WP_003821234.1.38178 WP_003821234.1.38328 WP_003821234.1.38534 WP_003821234.1.38923 WP_003821234.1.39109 WP_003821234.1.39143 WP_003821234.1.39323 WP_003821234.1.39544 WP_003821234.1.39649 WP_003821234.1.40067 WP_003821234.1.40089 WP_003821234.1.40139 WP_003821234.1.40287 WP_003821234.1.40381 WP_003821234.1.40521 WP_003821234.1.40671 WP_003821234.1.40699 WP_003821234.1.40717 WP_003821234.1.40885 WP_003821234.1.40905 WP_003821234.1.40936 WP_003821234.1.41152 WP_003821234.1.41181 WP_003821234.1.41295 WP_003821234.1.41354 WP_003821234.1.4140 WP_003821234.1.41420 WP_003821234.1.41565 WP_003821234.1.42055 WP_003821234.1.4233 WP_003821234.1.42334 WP_003821234.1.42416 WP_003821234.1.42497 WP_003821234.1.42576 WP_003821234.1.4318 WP_003821234.1.43230 WP_003821234.1.43238 WP_003821234.1.43282 WP_003821234.1.43291 WP_003821234.1.43400 WP_003821234.1.43401 WP_003821234.1.43734 WP_003821234.1.44190 WP_003821234.1.44232 WP_003821234.1.44259 WP_003821234.1.44349 WP_003821234.1.44451 WP_003821234.1.44576 WP_003821234.1.44662 WP_003821234.1.44958 WP_003821234.1.45070 WP_003821234.1.45311 WP_003821234.1.46219 WP_003821234.1.4628 WP_003821234.1.46321 WP_003821234.1.46447 WP_003821234.1.46719 WP_003821234.1.46778 WP_003821234.1.46785 WP_003821234.1.47170 WP_003821234.1.47512 WP_003821234.1.47517 WP_003821234.1.47818 WP_003821234.1.47874 WP_003821234.1.48179 WP_003821234.1.48301 WP_003821234.1.48344 WP_003821234.1.48641 WP_003821234.1.49081 WP_003821234.1.49649 WP_003821234.1.49980 WP_003821234.1.50490 WP_003821234.1.50707 WP_003821234.1.51064 WP_003821234.1.5120 WP_003821234.1.51286 WP_003821234.1.51344 WP_003821234.1.51362 WP_003821234.1.51769 WP_003821234.1.51879 WP_003821234.1.52025 WP_003821234.1.52065 WP_003821234.1.5222 WP_003821234.1.5240 WP_003821234.1.5290 WP_003821234.1.52986 WP_003821234.1.53067 WP_003821234.1.53156 WP_003821234.1.53271 WP_003821234.1.53477 WP_003821234.1.53604 WP_003821234.1.53618 WP_003821234.1.53654 WP_003821234.1.53658 WP_003821234.1.53791 WP_003821234.1.5380 WP_003821234.1.53816 WP_003821234.1.54042 WP_003821234.1.54106 WP_003821234.1.54204 WP_003821234.1.54460 WP_003821234.1.5457 WP_003821234.1.54628 WP_003821234.1.54632 WP_003821234.1.54710 WP_003821234.1.54734 WP_003821234.1.54904 WP_003821234.1.55255 WP_003821234.1.5531 WP_003821234.1.55350 WP_003821234.1.56056 WP_003821234.1.56084 WP_003821234.1.56254 WP_003821234.1.56330 WP_003821234.1.56421 WP_003821234.1.56752 WP_003821234.1.56758 WP_003821234.1.56782 WP_003821234.1.56892 WP_003821234.1.5701 WP_003821234.1.57082 WP_003821234.1.5712 WP_003821234.1.57255 WP_003821234.1.57383 WP_003821234.1.57552 WP_003821234.1.57713 WP_003821234.1.57806 WP_003821234.1.58338 WP_003821234.1.5837 WP_003821234.1.58529 WP_003821234.1.58577 WP_003821234.1.58765 WP_003821234.1.58806 WP_003821234.1.58896 WP_003821234.1.58923 WP_003821234.1.58964 WP_003821234.1.59089 WP_003821234.1.59128 WP_003821234.1.59319 WP_003821234.1.60003 WP_003821234.1.6039 WP_003821234.1.60428 WP_003821234.1.60747 WP_003821234.1.60780 WP_003821234.1.60837 WP_003821234.1.60856 WP_003821234.1.61051 WP_003821234.1.61242 WP_003821234.1.62052 WP_003821234.1.6229 WP_003821234.1.62500 WP_003821234.1.62599 WP_003821234.1.62940 WP_003821234.1.62965 WP_003821234.1.63049 WP_003821234.1.63136 WP_003821234.1.63205 WP_003821234.1.63299 WP_003821234.1.63640 WP_003821234.1.63728 WP_003821234.1.63754 WP_003821234.1.63791 WP_003821234.1.63948 WP_003821234.1.64270 WP_003821234.1.64318 WP_003821234.1.64375 WP_003821234.1.64451 WP_003821234.1.64622 WP_003821234.1.6471 WP_003821234.1.64999 WP_003821234.1.65148 WP_003821234.1.65861 WP_003821234.1.65865 WP_003821234.1.66032 WP_003821234.1.66036 WP_003821234.1.66098 WP_003821234.1.66177 WP_003821234.1.66583 WP_003821234.1.66618 WP_003821234.1.66638 WP_003821234.1.66798 WP_003821234.1.67435 WP_003821234.1.67535 WP_003821234.1.67743 WP_003821234.1.67928 WP_003821234.1.67933 WP_003821234.1.6801 WP_003821234.1.68280 WP_003821234.1.68311 WP_003821234.1.68338 WP_003821234.1.68516 WP_003821234.1.68884 WP_003821234.1.69041 WP_003821234.1.6922 WP_003821234.1.69494 WP_003821234.1.69590 WP_003821234.1.69618 WP_003821234.1.69751 WP_003821234.1.69835 WP_003821234.1.69885 WP_003821234.1.69935 WP_003821234.1.69949 WP_003821234.1.70145 WP_003821234.1.70388 WP_003821234.1.70426 WP_003821234.1.70575 WP_003821234.1.70715 WP_003821234.1.70740 WP_003821234.1.70854 WP_003821234.1.70866 WP_003821234.1.70972 WP_003821234.1.71157 WP_003821234.1.71181 WP_003821234.1.71349 WP_003821234.1.71489 WP_003821234.1.71506 WP_003821234.1.71774 WP_003821234.1.71889 WP_003821234.1.71963 WP_003821234.1.72041 WP_003821234.1.72076 WP_003821234.1.7212 WP_003821234.1.72199 WP_003821234.1.72213 WP_003821234.1.72312 WP_003821234.1.72409 WP_003821234.1.72456 WP_003821234.1.72670 WP_003821234.1.72737 WP_003821234.1.72849 WP_003821234.1.73143 WP_003821234.1.73290 WP_003821234.1.73474 WP_003821234.1.73787 WP_003821234.1.74018 WP_003821234.1.74166 WP_003821234.1.74203 WP_003821234.1.74209 WP_003821234.1.74467 WP_003821234.1.74492 WP_003821234.1.74613 WP_003821234.1.74634 WP_003821234.1.74903 WP_003821234.1.75340 WP_003821234.1.75646 WP_003821234.1.75754 WP_003821234.1.76046 WP_003821234.1.76310 WP_003821234.1.76380 WP_003821234.1.76506 WP_003821234.1.76527 WP_003821234.1.76691 WP_003821234.1.76901 WP_003821234.1.76950 WP_003821234.1.76959 WP_003821234.1.7758 WP_003821234.1.77597 WP_003821234.1.77807 WP_003821234.1.78117 WP_003821234.1.78299 WP_003821234.1.78490 WP_003821234.1.78627 WP_003821234.1.78721 WP_003821234.1.78958 WP_003821234.1.79121 WP_003821234.1.79194 WP_003821234.1.79301 WP_003821234.1.79623 WP_003821234.1.79624 WP_003821234.1.79643 WP_003821234.1.79978 WP_003821234.1.80271 WP_003821234.1.8033 WP_003821234.1.80800 WP_003821234.1.80838 WP_003821234.1.80851 WP_003821234.1.81051 WP_003821234.1.81135 WP_003821234.1.81411 WP_003821234.1.81501 WP_003821234.1.81757 WP_003821234.1.82018 WP_003821234.1.82054 WP_003821234.1.8207 WP_003821234.1.82146 WP_003821234.1.82152 WP_003821234.1.82356 WP_003821234.1.82364 WP_003821234.1.82559 WP_003821234.1.82588 WP_003821234.1.82632 WP_003821234.1.82713 WP_003821234.1.82734 WP_003821234.1.82751 WP_003821234.1.82940 WP_003821234.1.82972 WP_003821234.1.83190 WP_003821234.1.83298 WP_003821234.1.83392 WP_003821234.1.83406 WP_003821234.1.83428 WP_003821234.1.83507 WP_003821234.1.83509 WP_003821234.1.83669 WP_003821234.1.8381 WP_003821234.1.84043 WP_003821234.1.84078 WP_003821234.1.84114 WP_003821234.1.84624 WP_003821234.1.84856 WP_003821234.1.84859 WP_003821234.1.84958 WP_003821234.1.85121 WP_003821234.1.85139 WP_003821234.1.854 WP_003821234.1.85499 WP_003821234.1.85839 WP_003821234.1.86167 WP_003821234.1.86301 WP_003821234.1.86388 WP_003821234.1.86428 WP_003821234.1.86480 WP_003821234.1.86642 WP_003821234.1.86646 WP_003821234.1.87159 WP_003821234.1.87233 WP_003821234.1.87469 WP_003821234.1.87992 WP_003821234.1.8802 WP_003821234.1.88160 WP_003821234.1.88310 WP_003821234.1.88486 WP_003821234.1.88494 WP_003821234.1.88542 WP_003821234.1.88901 WP_003821234.1.88921 WP_003821234.1.89075 WP_003821234.1.89192 WP_003821234.1.89488 WP_003821234.1.89642 WP_003821234.1.89947 WP_003821234.1.90523 WP_003821234.1.90858 WP_003821234.1.91105 WP_003821234.1.91309 WP_003821234.1.91389 WP_003821234.1.91439 WP_003821234.1.91845 WP_003821234.1.91932 WP_003821234.1.91988 WP_003821234.1.92256 WP_003821234.1.92285 WP_003821234.1.92528 WP_003821234.1.92942 WP_003821234.1.93268 WP_003821234.1.9334 WP_003821234.1.93362 WP_003821234.1.9367 WP_003821234.1.93807 WP_003821234.1.93850 WP_003821234.1.93966 WP_003821234.1.93987 WP_003821234.1.94019 WP_003821234.1.94250 WP_003821234.1.94266 WP_003821234.1.94283 WP_003821234.1.94386 WP_003821234.1.94521 WP_003821234.1.94524 WP_003821234.1.9476 WP_003821234.1.94832 WP_003821234.1.95061 WP_003821234.1.95166 WP_003821234.1.95221 WP_003821234.1.95421 WP_003821234.1.95487 WP_003821234.1.95504 WP_003821234.1.95591 WP_003821234.1.95608 WP_003821234.1.95637 WP_003821234.1.95694 WP_003821234.1.95814 WP_003821234.1.96102 WP_003821234.1.96130 WP_003821234.1.96199 WP_003821234.1.96241 WP_003821234.1.96400 WP_003821234.1.96719 WP_003821234.1.9688 WP_003821234.1.969 WP_003821234.1.97215 WP_003821234.1.97275 WP_003821234.1.9744 WP_003821234.1.97750 WP_003821234.1.97985 WP_003821234.1.98081 WP_003821234.1.98149 WP_003821234.1.9825 WP_003821234.1.98258 WP_003821234.1.98303 WP_003821234.1.98580 WP_003821234.1.98669 WP_003821234.1.98995 WP_003821234.1.99135 WP_003821234.1.99254 WP_003821234.1.99261 WP_003821234.1.99407 WP_003821234.1.99607 WP_003821234.1.99644 WP_003821234.1.9977 WP_003821234.1.99857 WP_003821234.1.99971 YP_006897197.1.34978 YP_006970565.1.84680 gi|384203269|ref|YP_005589008.1| gi|33591966|ref|NP_879610.1| gi|410421330|ref|YP_006901779.1| gi|410473916|ref|YP_006897197.1| 257311.BPP3431 257313.BP0795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]