SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 257314.LJ0518 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  257314.LJ0518
Domain Number 1 Region: 28-341
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.71e-93
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000503
Further Details:      
 
Domain Number 2 Region: 340-488
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-22
Family Glycosyl hydrolases family 32 C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 257314.LJ0518
Sequence length 489
Comment (Lactobacillus johnsonii NCC 533)
Sequence
MEWTREQRYRKYKDWDAQTLLNLQAQAATSPYQMHYHIHPLSGLINDPNGFSYYNGEYHL
FCQSYPFGPVHGVKSWIHYASPDLVHWHYLGSAIDPDSDLDNAGAYSGSAMEHDGKLLLM
YTGNHRDKDWTRIPYQVIAEMDKDNHITKPKDPAILPPDHVSEHFRDPQLFEHDGKYYVL
LGAQDAKTKKGHIDIYESTDLKNWHENGYLDLGKDEMGYMIECPNLVFINNYPVLIFCPQ
GLDKSVADYKNIYPNMYWIGKDINLSEAKFAPLQEKPANLDDGFDVYATQAFNAPDGNAY
AISWVGLPDCTYPTDKENWANCYSQVKRLEIKDGALYQHPVDAIKKLRHNEKQLNNEKII
SQAAGKQYELKLHLLAGQSGKLHLASNEDLSSSLVLDFNTDKNAKLTIDRASSGPAVNPD
YGATRTIDLKDDQDLDLDIFIDGSLCEIFINNGRHVATLRFFAPTPNQKIAFDKDTKYTG
RLWSMNSIL
Download sequence
Identical sequences Q74HI7
WP_011162547.1.27409 257314.LJ0518 gi|42519807|ref|NP_965737.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]