SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 257314.LJ1207 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  257314.LJ1207
Domain Number 1 Region: 1-228
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.75e-46
Family GHMP Kinase, N-terminal domain 0.0003
Further Details:      
 
Domain Number 2 Region: 211-351
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.15e-32
Family Phosphomevalonate kinase (PMK) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 257314.LJ1207
Sequence length 357
Comment (Lactobacillus johnsonii NCC 533)
Sequence
MITEQAPGKLYIAGEYAVLEQNCPAILVAVNEFVRVSIAKSTGTSGLIHSKQYSQDSIHW
IRKGNQMVIDNRDNPFEYILSAINFTERFCLEQKVSMSLYDLHVNSDLDSADGKKYGLGS
SAAVTVATVKAILNFYGLHCTKDLIFKLSAISHYSVQGNGSAGDIAASVYGGWLAYQTFD
KAWLKKELATKSLSEVLNEAWPGLKIQLLTPPEGLNLVIGWSQKPASTSQLVDKTNAKKK
FIKTQYDTFLDESRKCVLDMIKGFNEKNISLIQKQIRLNRQLLKDFASLNHIAIEIPRLT
KLINIAEQFNGAAKTSGAGNGDCGIVIADEKTDIEEMKNNWRKNGIMPLNFLVHSIA
Download sequence
Identical sequences A0A1B3PS78 F4AE52 Q74JA2 V5P2V9
WP_011162036.1.13362 WP_011162036.1.27409 WP_011162036.1.27769 WP_011162036.1.28348 WP_011162036.1.40168 WP_011162036.1.43572 WP_011162036.1.46682 WP_011162036.1.54950 WP_011162036.1.56141 WP_011162036.1.58924 WP_011162036.1.64510 WP_011162036.1.65350 gi|42519132|ref|NP_965062.1| gi|385825889|ref|YP_005862231.1| 257314.LJ1207 gi|560152199|ref|YP_008845037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]