SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 257363.RT0489 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  257363.RT0489
Domain Number 1 Region: 301-469
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.33e-43
Family Ribonuclease PH domain 1-like 0.0000256
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-41
Family Ribonuclease PH domain 1-like 0.0000899
Further Details:      
 
Domain Number 3 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.68e-27
Family Ribonuclease PH domain 2-like 0.0000996
Further Details:      
 
Domain Number 4 Region: 149-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.4e-25
Family Ribonuclease PH domain 2-like 0.0029
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.5e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 6 Region: 621-696
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.84e-17
Family Cold shock DNA-binding domain-like 0.00096
Further Details:      
 
Domain Number 7 Region: 228-326
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 6.54e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 257363.RT0489
Sequence length 745
Comment (Rickettsia typhi wilmington)
Sequence
MFNEITKSVIWNRQVLEISTGKIARQADAAVTVKMGNSILLCTCVVANKVKDGIGFFPLT
INYREMAYSAGKIPGGFLKREGKASDKEILVSRLIDRPIRPLFHQAFIHETHITCSVLSY
DPETPVDILAIIGASAALSISPAPYLEIVAASKVGLINGEFVLNPTLELLKTSQLDLVVA
GTKDSVMMVESEAHLLSEEKMLEAIKFGFENFQTVIKLIKEFAKEAKKPKFEMQDLYPSS
LKKEIGKLFAKEIEQAFAIKSKQERNANLALIHEKVLTHFVCDIENKKYNNYQIESTLKA
ISADILRNKILEQNIRIDGRSTTDIRQIACEVGLLPSAHGSALFTRGETQSLVSTTFGTS
LDEQIVDSLEGEYKERFMLNYIFPPYSVNEAMPMKAPSRREVGHGKLAWRAINPILPNKV
QFPYSIRVVAETTESNGSSSMATVCGSSLALMYAGVPIKAPVAGIAMGLIKEGDKFAILS
DIIGDEDYFGDMDFKVAGTSKGITALQMDIKISGIDFKIIQVALEQARHGRLHILEQMNK
IISKPNSELSKNAPSSTTIKIDKDKIKDIIGPGGKIIKEICETSNAKIDISDDGTVSVYA
ADRDKIKVALDKIKAIAVEPEIGEIFNGTVMKVLDSGAFINYLGNKDGFVHISEISETRI
DKVSSVLKQGDIVKVKLIGFDNKGKAKLTIKNACKDHSLNNPKQKNNVKEDSEPEQRRDA
SKKRTWNEDNNTEMSEVITERKYFT
Download sequence
Identical sequences Q68WN1
gi|383843300|ref|YP_005423803.1| WP_011190943.1.11799 WP_011190943.1.3094 WP_011190943.1.57022 gi|383752464|ref|YP_005427564.1| 257363.RT0489 gi|51473686|ref|YP_067443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]