SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 257363.RT0804 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  257363.RT0804
Domain Number 1 Region: 9-98
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 1.7e-29
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.00079
Further Details:      
 
Domain Number 2 Region: 99-136
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000285
Family Prokaryotic DksA/TraR C4-type zinc finger 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 257363.RT0804
Sequence length 143
Comment (Rickettsia typhi wilmington)
Sequence
MLETPKLPIGYKPSKDEEYMCPNHLEYFRQKLLRWKEDLLKESQATLNHLKEENLKESDL
NDCATHETERAFELRSRNRYCKLMSKIEEALSRIKNGEYGYCEETGAPIGIKRLEARPIA
ALCIEAQERHENYERSHLDEPGN
Download sequence
Identical sequences Q68VT3
WP_011191233.1.11799 WP_011191233.1.3094 WP_011191233.1.57022 257363.RT0804 gi|383843594|ref|YP_005424097.1| gi|51473984|ref|YP_067741.1| gi|383752759|ref|YP_005427859.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]