SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 258594.RPA4143 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  258594.RPA4143
Domain Number 1 Region: 8-146
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.45e-31
Family cAMP-binding domain 0.0053
Further Details:      
 
Domain Number 2 Region: 150-226
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.27e-21
Family CAP C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 258594.RPA4143
Sequence length 236
Comment (Rhodopseudomonas palustris CGA009)
Sequence
MATIDTSMVAKLPLFAGLSRAELDAVLKEAQSIRVPKNGHVFEQGEDAHSFFVLLHGHVR
ASKVTPAGEQIVVRYVAPGETLGVAMAIGLNRYPATATAVDDSIVLAWPTAAWPRLVEQY
PALATNTLRTVGGRLQETHSRVVEMSTQQVEQRVAHALLRLAKQSGRKVENGVQIDFPIS
RQDIAQMTGTTLHTVSRLLSGWEQKGLIESGRQKIVLREPHQLVVLADQAPDDKTS
Download sequence
Identical sequences B3QKL5 Q6N2A7
gi|39937203|ref|NP_949479.1| WP_011159678.1.13849 WP_011159678.1.60452 WP_011159678.1.81860 258594.RPA4143 395960.Rpal_4621 gi|192292982|ref|YP_001993587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]