SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 259536.Psyc_0074 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  259536.Psyc_0074
Domain Number 1 Region: 298-493
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.57e-45
Family Ribonuclease PH domain 1-like 0.0000156
Further Details:      
 
Domain Number 2 Region: 2-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.27e-43
Family Ribonuclease PH domain 1-like 0.0000431
Further Details:      
 
Domain Number 3 Region: 455-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.24e-30
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 146-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.05e-29
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 5 Region: 561-645
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.72e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 6 Region: 625-697
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.22e-20
Family Cold shock DNA-binding domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 259536.Psyc_0074
Sequence length 700
Comment (Psychrobacter arcticum 273-4)
Sequence
MTMFNTIKREFQYGNQQVVIETGRIARQANSILVHMGGVTVLVAAVVKSDAKEGQNFFPL
TVNYQEKMYAAGKIPGAYGKREGRASESETLTSRLIDRPIRPLFPEGYVNEIQITATVVS
SDKTQSADIAALIGASAALAISDAPFNGPVAAARVGFINGEYVLNPTLEELKESDLDLVV
AGTKSAVLMVESEAAELSEDQMLGAVLYGHQQQQIVIDNIASMAAEIGTAKQQYTAPVRD
QALETGMKEQFGAQVSDAYTITDKQARYSKLNEIKDAAIVALAGDAESESYSDTVSELKE
IYNDLKYRTVRDNILSGKPRIDGRDLETVRALDVQVGVLPFTHGSALFTRGETQALVTTT
LGNTRDVNMIDSLAGTIRDHFMLHYNFPHFSVGETGREGIPKRREIGHGRLARRGVQAML
PDSDRFPYVIRVVSEITESNGSSSMASVCGASLALMDAGVPIKAPVAGIAMGLVKEGERF
AVLSDILGDEDHLGDMDFKVAGSKDGITALQMDIKIEGITPDIMEQALKQAHAGRIHILD
AMNKVLPESRTEINAHAPNYAVIEINPDKIRDVIGKGGATIRQLTEETGAVIDIDDAGTI
RIFGENKAATKAAIAKIEAITAEVEVGKTYEGTVARIVDFGAFVNVLPNTDGLVHISQIA
DERVENVSDYLKEGQIVKVLVQDVDNRGRIKLTMKGIEQS
Download sequence
Identical sequences Q4FVL0
WP_011279387.1.27963 259536.Psyc_0074 gi|71064655|ref|YP_263382.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]