SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 259536.Psyc_1575 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  259536.Psyc_1575
Domain Number 1 Region: 192-342
Classification Level Classification E-value
Superfamily HlyD-like secretion proteins 1.7e-44
Family HlyD-like secretion proteins 0.0000154
Further Details:      
 
Domain Number 2 Region: 60-124
Classification Level Classification E-value
Superfamily HlyD-like secretion proteins 3.01e-18
Family HlyD-like secretion proteins 0.00079
Further Details:      
 
Domain Number 3 Region: 130-190
Classification Level Classification E-value
Superfamily HlyD-like secretion proteins 0.0000000157
Family HlyD-like secretion proteins 0.0025
Further Details:      
 
Weak hits

Sequence:  259536.Psyc_1575
Domain Number - Region: 368-419
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0195
Family PDZ domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 259536.Psyc_1575
Sequence length 448
Comment (Psychrobacter arcticum 273-4)
Sequence
MKHSYLALVIATVLSGAVLVGCDKKEDAAGDAAAAQQQMPPSVVNVQTVTFDTVPQVQIF
AGRTAAYQTADVRPQVSGIIDEVLFREGSNVKKGQPLYRINTDNYATSITSGQAAIAQAE
ANYQTALANNANAKADLASRQASLSQAQNDLQRLQGLVAIDAISKQQYDQAQTTVRTAQA
AVQSANAAISQSQAGIESAKAGIQTAKAGLQASTLDLNRTIVRAPISGRTDRSSVTAGTL
VSSGQPTPLVTISRLDPIYVDISQSSSELLKLRQQISAGKAQAGMNSVELVLEDGSTYPV
RGELALSEAKVDESTGAVTLRAVFPNNSNILLPGMYVSARLTQSVITNAALVPQSAVMRS
TKSETQVYIVDENNKIQVRPVTINGTYQGQWVVTDGLQAGDKVVIIGGAKVKPEQEVIAK
PLENPNPAPAAKKAAAKTPQQAAQSAAK
Download sequence
Identical sequences Q4FRD5
259536.Psyc_1575 WP_011280839.1.27963 gi|71066130|ref|YP_264857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]