SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 260799.BAS0777 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  260799.BAS0777
Domain Number 1 Region: 52-315
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.69e-35
Family GpdQ-like 0.0068
Further Details:      
 
Domain Number 2 Region: 457-659
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-30
Family Trypanosoma sialidase, C-terminal domain 0.052
Further Details:      
 
Domain Number 3 Region: 349-448
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000448
Family Fibronectin type III 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 260799.BAS0777
Sequence length 824
Comment (Bacillus anthracis str Sterne)
Sequence
MRRIHVDRTALRKVKGLIGLLMVFVLAFVSFPWSTSVKAEEKKQEKVPSEKKIVFPVVSD
VHIKNSGTDDTFRWKRAIEQLNTLAPKQDAFVIVGDFTDTGSLQQYDRFMQVYNENENKD
AVRMNSLGNHDYWNGLSVEGAQKRFLEKTGMESIYYHKVVKGYHFLVMSPENGTTHGYYS
DKQINWLKEEMAKAQKDDPEKPIFVFLHQHIKETVYGSHEWGTQDSAKINAVLKEYPQAI
TFSGHSHYPLDDPRSIHQKDFTSVGTSSISYMEVEGGKVQGNIPPGASTLSQGLLVEVDD
EEVTINRRDFHTNSWTGEPWKIKLPAKKETFTHVEDRDKEKPSFSTDAKLSVSNVTENAA
TVTFPQALDNLLVHSYRVQARDKQTGEIKNKLLAFSEFYRDPVPKDLTFTLAGLDGGKTY
TLEVVAIDSFGNESAQPLTAEVTTKKDNIDPNVKVPKADVFDVNFLDGTFKDNSSFGTKG
DVKGNVSIAYDKALKTNVMKLNGQANTFGYLPFSAAQKEKVANTFTLETVFSMNEIRGQG
ILQNTESGGIGFESTGSGNVELWAHIGGSYKRVGVQLEANKTYHLTGTYNGSEVAIYVDG
KKANSQPAKGKVSHPNVPFAFGADPDSNGNGGIPLNGQIALARLYSKALSSSEVLAAYNE
FSNRTKLEQVNALYEELGKVKEVLAGTYEFGDKPGQYSKEAFQELEKSYNNAKQAFENVG
STGEQIVQTYNELKTANVTFVQSKVVEQPKTPKEKLQINIESAKAVVKKAQDANVTDGSV
KALSQKITVAETVVKDVKVKDAQVETMNRTLEYTISLVEKSINK
Download sequence
Identical sequences A0A0F7RMV8
260799.BAS0777 gi|49183801|ref|YP_027053.1| WP_011178646.1.100214 WP_011178646.1.10208 WP_011178646.1.11427 WP_011178646.1.11676 WP_011178646.1.13115 WP_011178646.1.13233 WP_011178646.1.13820 WP_011178646.1.14721 WP_011178646.1.14855 WP_011178646.1.15460 WP_011178646.1.15569 WP_011178646.1.16170 WP_011178646.1.16997 WP_011178646.1.18976 WP_011178646.1.19258 WP_011178646.1.19435 WP_011178646.1.19445 WP_011178646.1.20390 WP_011178646.1.20680 WP_011178646.1.21021 WP_011178646.1.21258 WP_011178646.1.21776 WP_011178646.1.22865 WP_011178646.1.23269 WP_011178646.1.2419 WP_011178646.1.24334 WP_011178646.1.24556 WP_011178646.1.24608 WP_011178646.1.25716 WP_011178646.1.25752 WP_011178646.1.2618 WP_011178646.1.26665 WP_011178646.1.26721 WP_011178646.1.28427 WP_011178646.1.28729 WP_011178646.1.29101 WP_011178646.1.29787 WP_011178646.1.30110 WP_011178646.1.31490 WP_011178646.1.3236 WP_011178646.1.32576 WP_011178646.1.33175 WP_011178646.1.33338 WP_011178646.1.33367 WP_011178646.1.33740 WP_011178646.1.33876 WP_011178646.1.35684 WP_011178646.1.35886 WP_011178646.1.36305 WP_011178646.1.36763 WP_011178646.1.38036 WP_011178646.1.39781 WP_011178646.1.40550 WP_011178646.1.41165 WP_011178646.1.41675 WP_011178646.1.4439 WP_011178646.1.45305 WP_011178646.1.45533 WP_011178646.1.46236 WP_011178646.1.46699 WP_011178646.1.47145 WP_011178646.1.4763 WP_011178646.1.47644 WP_011178646.1.47798 WP_011178646.1.51749 WP_011178646.1.52794 WP_011178646.1.53137 WP_011178646.1.53493 WP_011178646.1.53683 WP_011178646.1.54117 WP_011178646.1.54189 WP_011178646.1.55958 WP_011178646.1.56042 WP_011178646.1.56176 WP_011178646.1.56270 WP_011178646.1.56959 WP_011178646.1.58160 WP_011178646.1.59095 WP_011178646.1.59310 WP_011178646.1.59575 WP_011178646.1.60402 WP_011178646.1.61213 WP_011178646.1.63560 WP_011178646.1.68607 WP_011178646.1.69203 WP_011178646.1.69822 WP_011178646.1.69894 WP_011178646.1.70065 WP_011178646.1.70996 WP_011178646.1.72704 WP_011178646.1.73325 WP_011178646.1.74226 WP_011178646.1.74538 WP_011178646.1.75499 WP_011178646.1.75870 WP_011178646.1.76125 WP_011178646.1.76783 WP_011178646.1.77668 WP_011178646.1.77824 WP_011178646.1.78644 WP_011178646.1.79315 WP_011178646.1.79584 WP_011178646.1.80439 WP_011178646.1.80695 WP_011178646.1.81799 WP_011178646.1.82289 WP_011178646.1.83951 WP_011178646.1.84045 WP_011178646.1.85689 WP_011178646.1.86119 WP_011178646.1.86140 WP_011178646.1.86239 WP_011178646.1.86288 WP_011178646.1.8698 WP_011178646.1.8825 WP_011178646.1.88641 WP_011178646.1.90791 WP_011178646.1.90883 WP_011178646.1.9186 WP_011178646.1.92686 WP_011178646.1.92831 WP_011178646.1.93271 WP_011178646.1.93744 WP_011178646.1.93927 WP_011178646.1.94322 WP_011178646.1.94784 WP_011178646.1.96934 WP_011178646.1.97861 WP_011178646.1.98216 WP_011178646.1.99445 WP_011178646.1.99485 WP_011178646.1.99994 YP_027053.1.16718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]