SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 261594.GBAA1551 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  261594.GBAA1551
Domain Number - Region: 48-101
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00304
Family Matrix metalloproteases, catalytic domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 261594.GBAA1551
Sequence length 226
Comment (Bacillus anthracis Ames 0581)
Sequence
MFYLIYFAIILIIPLYAQSKVRSAYSKYSQVYSTSGMTGAEVARKILDENGLYNVAVEET
PGHLSDHYDPTAKTVRLSTDNYYGHSVAGTAVAAHEVGHAIQDAKDYNFMRIRHSLVPVA
NFGSNISWIFIMIGAFASMANLLLLGIILMAAGVVFQLVTLPVEFDASKRAMQQIEALGI
VSTDEYGQARKVLNAAALTYVAAAAVAVFELLRLVLMYTGMQRSDE
Download sequence
Identical sequences Q81SU4
NP_844001.1.87267 gi|47777945|ref|YP_018173.2| 198094.BA_1551 261594.GBAA1551 gi|30261624|ref|NP_844001.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]