SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 261594.GBAA2973 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  261594.GBAA2973
Domain Number - Region: 298-334
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0348
Family Glycosyl hydrolases family 16 0.025
Further Details:      
 
Domain Number - Region: 63-102
Classification Level Classification E-value
Superfamily Aspartate receptor, ligand-binding domain 0.0628
Family Aspartate receptor, ligand-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 261594.GBAA2973
Sequence length 348
Comment (Bacillus anthracis Ames 0581)
Sequence
MRTQEQIVNLFRNFSIKECKGSSDLYEYLSIKIAEDEEVLTLSSYAQAGQPVPNLLLGAV
HYLLLAGKEHHLKTYYSSLVESANTNLDQAFHHFKDFCKMYREEIITLLQTKLVQTNEVR
RCAYLYPSFNYIFNKVNKPLALIEIGTSSGLQLFWDQYSYSYGTGESYGNINSNVHVTSE
IRGENVPQLLKESPPVVERIGLDLHVNDLHSDEDYLWLRALIWPEHKERLELFDQAASLV
KNKSVQLIEGDGVELLPSIIEQISEDAVICIFHTHVANQIPEQVKRKLEKQIQEIGAKRD
VFHLYNNMWDRDLHIDYYINGNEYRETVGETEGHGRWFSWKLGKETLI
Download sequence
Identical sequences A0A0F7RCR4 Q81P45
gi|30262930|ref|NP_845307.1| 198094.BA_2973 260799.BAS2761 261594.GBAA2973 568206.BAMEG_1632 592021.BAA_3025 NP_845307.1.87267 WP_001260261.1.100214 WP_001260261.1.100595 WP_001260261.1.10208 WP_001260261.1.11427 WP_001260261.1.11676 WP_001260261.1.13115 WP_001260261.1.13233 WP_001260261.1.13820 WP_001260261.1.14721 WP_001260261.1.14855 WP_001260261.1.15460 WP_001260261.1.15569 WP_001260261.1.16170 WP_001260261.1.16997 WP_001260261.1.17146 WP_001260261.1.18976 WP_001260261.1.19258 WP_001260261.1.19435 WP_001260261.1.19445 WP_001260261.1.20390 WP_001260261.1.20680 WP_001260261.1.21021 WP_001260261.1.21258 WP_001260261.1.21776 WP_001260261.1.22865 WP_001260261.1.2419 WP_001260261.1.24334 WP_001260261.1.24556 WP_001260261.1.24608 WP_001260261.1.25716 WP_001260261.1.25752 WP_001260261.1.2618 WP_001260261.1.26665 WP_001260261.1.26721 WP_001260261.1.27644 WP_001260261.1.27987 WP_001260261.1.28427 WP_001260261.1.28729 WP_001260261.1.29101 WP_001260261.1.29787 WP_001260261.1.30110 WP_001260261.1.3236 WP_001260261.1.32576 WP_001260261.1.33175 WP_001260261.1.33338 WP_001260261.1.33367 WP_001260261.1.33740 WP_001260261.1.33876 WP_001260261.1.34646 WP_001260261.1.35684 WP_001260261.1.35886 WP_001260261.1.36305 WP_001260261.1.36763 WP_001260261.1.38036 WP_001260261.1.39781 WP_001260261.1.40550 WP_001260261.1.41165 WP_001260261.1.41675 WP_001260261.1.4439 WP_001260261.1.45305 WP_001260261.1.45533 WP_001260261.1.46236 WP_001260261.1.46699 WP_001260261.1.47145 WP_001260261.1.4763 WP_001260261.1.47644 WP_001260261.1.47798 WP_001260261.1.51749 WP_001260261.1.52794 WP_001260261.1.53137 WP_001260261.1.53493 WP_001260261.1.53683 WP_001260261.1.54117 WP_001260261.1.54189 WP_001260261.1.55811 WP_001260261.1.55958 WP_001260261.1.56042 WP_001260261.1.56176 WP_001260261.1.56959 WP_001260261.1.58160 WP_001260261.1.59095 WP_001260261.1.59310 WP_001260261.1.59575 WP_001260261.1.60402 WP_001260261.1.61213 WP_001260261.1.63560 WP_001260261.1.68607 WP_001260261.1.69203 WP_001260261.1.69822 WP_001260261.1.69894 WP_001260261.1.70065 WP_001260261.1.70996 WP_001260261.1.72704 WP_001260261.1.73325 WP_001260261.1.74226 WP_001260261.1.74538 WP_001260261.1.75499 WP_001260261.1.75870 WP_001260261.1.76125 WP_001260261.1.76783 WP_001260261.1.77668 WP_001260261.1.77824 WP_001260261.1.78644 WP_001260261.1.79315 WP_001260261.1.80439 WP_001260261.1.80695 WP_001260261.1.81799 WP_001260261.1.82289 WP_001260261.1.83951 WP_001260261.1.84045 WP_001260261.1.85689 WP_001260261.1.86119 WP_001260261.1.86140 WP_001260261.1.86239 WP_001260261.1.86288 WP_001260261.1.8698 WP_001260261.1.8825 WP_001260261.1.88641 WP_001260261.1.90791 WP_001260261.1.90883 WP_001260261.1.9186 WP_001260261.1.92686 WP_001260261.1.92831 WP_001260261.1.93271 WP_001260261.1.93744 WP_001260261.1.93927 WP_001260261.1.94237 WP_001260261.1.94322 WP_001260261.1.94784 WP_001260261.1.96934 WP_001260261.1.97781 WP_001260261.1.97861 WP_001260261.1.98216 WP_001260261.1.99445 WP_001260261.1.99485 WP_001260261.1.99994 YP_029019.1.16718 gi|49185767|ref|YP_029019.1| gi|229604090|ref|YP_002867215.1| gi|227814224|ref|YP_002814233.1| gi|386736708|ref|YP_006209889.1| gi|47528266|ref|YP_019615.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]