SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 262316.MAP1655c from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  262316.MAP1655c
Domain Number - Region: 5-87
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0306
Family YVTN repeat 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 262316.MAP1655c
Sequence length 126
Comment (Mycobacterium avium paratuberculosis)
Sequence
MRWIVDGMNVIGSRPDGWWKDRDGAMVALVQRLDRWASGRDDDVTVVFERPPAAVVTSSV
IGIAHAPRAAANSADDEIVRLVTADPDPPGICVVTSDRTLAERVRNLGARVQGSDSFRDL
IEPRHR
Download sequence
Identical sequences Q73ZE8 V7J2G7 V7JGR8 V7KIC3 V7KPA3 V7LDW9
gi|499076522|ref|YP_007972000.1| 262316.MAP1655c gi|41407753|ref|NP_960589.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]