SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 262543.Exig_1284 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262543.Exig_1284
Domain Number 1 Region: 14-129
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000589
Family SMI1/KNR4-like 0.015
Further Details:      
 
Weak hits

Sequence:  262543.Exig_1284
Domain Number - Region: 214-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0435
Family Legume lectins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 262543.Exig_1284
Sequence length 291
Comment (Exiguobacterium sibiricum 255 15)
Sequence
MSKLIKRLHPDSKMPGVSAVDLKKAEHALGVLFPDEYKDLFLQTNGAQFGEWTLYPIPTR
RTVSIDLVRHNEKRPAGLPDDLICIGENMTGDKLCYRIRKRFLQELVFRWNEKTGIAKYP
SSSLEQFVDWHVPKRKTNQVHRLGCFTVESDELIVTDPYYGLEEGTDLQLILPNVKSGSW
TAAIIYTEDDWVKQLLVFEGNKKRSGKWHRQEQPIGVDSALVGIFDGTAYRQHQATEFET
VVSVDDQAGIVSFGAVSTSGFGDGLYDVDIQYDVSRQIVGVRVNFAEEDSY
Download sequence
Identical sequences B1YF81
WP_012370178.1.68707 gi|172057314|ref|YP_001813774.1| 262543.Exig_1284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]