SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 262543.Exig_1571 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262543.Exig_1571
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000000281
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 262543.Exig_1571
Sequence length 237
Comment (Exiguobacterium sibiricum 255 15)
Sequence
MSDQLQKALLTARSVIENRYPDCDAALLAGSFVRGQATATSDLDLVVFYESVAASYRESF
TFDQYPVEAFIHSSTTIREFFRQDRERGRPSMQRMVAEGLVVRDHPMLVPLKTQAETELL
AGPPVLSLTEMNRARYFLTDLLDDFIGVSDRTDGLGIAARLLEQATDFRLRASGHWTGQG
KWLIRSLAIVDPVEAKRLTDAFNVYFRSDQKQAVIDLVEQWLDSHGGRYFDGFSIGK
Download sequence
Identical sequences B1YGM3
WP_012370447.1.68707 gi|172057584|ref|YP_001814044.1| 262543.Exig_1571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]