SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 262543.Exig_1832 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262543.Exig_1832
Domain Number 1 Region: 7-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-51
Family Ribonuclease PH domain 1-like 0.0000174
Further Details:      
 
Domain Number 2 Region: 295-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.94e-49
Family Ribonuclease PH domain 1-like 0.0000187
Further Details:      
 
Domain Number 3 Region: 452-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.64e-30
Family Ribonuclease PH domain 2-like 0.0000996
Further Details:      
 
Domain Number 4 Region: 138-230
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.23e-27
Family Ribonuclease PH domain 2-like 0.0024
Further Details:      
 
Domain Number 5 Region: 557-642
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.01e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 6 Region: 623-697
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.72e-18
Family Cold shock DNA-binding domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 262543.Exig_1832
Sequence length 739
Comment (Exiguobacterium sibiricum 255 15)
Sequence
MSQTKQTFSTELGGRPLTIEIGQLAKQANGAALIRYGETAVLATVVASKQPKDLDFFPLT
VNYEEKLYAAGKIPGGFLKREGRPGENAILTSRLIDRPIRPLFPDGFRHDIQVATTVLSS
DEDNSPEVAAMIGASIALSISDIPFDGPIAGVTIGRVNGEFIINPTMSQASESDIDLQVA
GTKHAVNMVEAGAKEVSEQAMLEAILLGHDVIKELIAFQEEIVAAVGQEKFAYTVASFDE
TLVNRLKAEALAEVTTAVQVEEKQARDLAINEVISKYIDQYAADDSITEAQLAEVSGVLN
KFVKTEVRRLITEDKVRPDGRGLAEIRPLDSEIGLLPRAHGSGLFTRGQTQVLSVATLGV
AGDAQIIDGLGLKAEKRFMHHYNFPPFSVGEARPMRAPGRREIGHGALGERALLPVLPSE
TDFPYTIRLVSEVLESNGSSSQASICGSILAMMDAGVPLKAPVAGIAMGLIKEGENYSIL
TDIQGMEDHLGDMDFKVAGTKDGVTALQMDMKIGGITRQILEEALEQARLGRLHILEHMN
SVIAEPRVELSKYAPKIVTLKINPDKIRDVIGPGGKVINGIIDETGVKIDIDQDGTVFIA
STDQDGINHARQLIEDIVREVVIGEEFDGTVRRVEKFGAFVELFKGKDALVHISELALER
VGQTEDVVKLGDKLKVRVTEVDDKGRVNASHKVLLVEGMSPEDRAAYDEKKKTERDSRPP
RRDTGSRPPRDGQRPPRRN
Download sequence
Identical sequences B1YI57
gi|172057841|ref|YP_001814301.1| WP_012370702.1.68707 262543.Exig_1832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]