SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 262722.MHP7448_0122 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262722.MHP7448_0122
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily L28p-like 2.16e-18
Family Ribosomal protein L28 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 262722.MHP7448_0122
Sequence length 64
Comment (Mycoplasma hyopneumoniae 7448)
Sequence
MARKDQISHRGPLSGNNRSHALNATKRKFNLNLQQITLKTASGKKIRLKVSAKTKKTLRK
WGQV
Download sequence
Identical sequences Q4A8P2 S5FZT3
gi|72080462|ref|YP_287520.1| gi|525903307|ref|YP_008291550.1| WP_011290023.1.35737 WP_011290023.1.4867 262722.MHP7448_0122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]