SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 262723.MS53_0263 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  262723.MS53_0263
Domain Number - Region: 43-175
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.017
Family Phase 1 flagellin 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 262723.MS53_0263
Sequence length 183
Comment (Mycoplasma synoviae 53)
Sequence
MIQKYKPNLGLIINKIYWDGFMPKIVVPGYEADTTGRNKDTNEAANLEKLKTWFDTPANW
EKLAEQLTKKLGSDKFKNVTLTNPQVSYEEVTVNSNTWKNPKVTFTVEAKPGYELTQPTT
DSKQISLTIRVLYSSQESNQNLLTIQGASPVAAPNTASADNPASAIKNVNVYLNYINQFK
LTN
Download sequence
Identical sequences 262723.MS53_0263 gi|71894285|ref|YP_278393.1| WP_011283419.1.35279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]