SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 263820.PTO0762 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  263820.PTO0762
Domain Number 1 Region: 3-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.7e-47
Family Peptidase A4 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 263820.PTO0762
Sequence length 227
Comment (Picrophilus torridus DSM 9790)
Sequence
MEWVHQTGAGYVVATDFGSPKPEVTGVSGSWIVQNVNASCSCTYSAQWVGIGGFFNGDSS
LIQAGTTSQYDCGASFSAWYEILPAAETPINMTVYPGNIINVHIFLAKSPDLWYIYLNDT
SENERFFKEVYYNSSMLSAEWIEERPEINGQLSCLSDFGTAYYGGYYTGLSMSDYATVNG
QTAPISSFQYENITMVSNSGIIAEPGNIINNGSFKVYYTVESCCCFF
Download sequence
Identical sequences Q6L105
WP_011177563.1.10384 263820.PTO0762 gi|48477834|ref|YP_023540.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]