SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264198.Reut_A0957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264198.Reut_A0957
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.83e-51
Family Ribonuclease PH domain 1-like 0.0000104
Further Details:      
 
Domain Number 2 Region: 297-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.71e-49
Family Ribonuclease PH domain 1-like 0.0000159
Further Details:      
 
Domain Number 3 Region: 147-238
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.26e-30
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 452-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.89e-28
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 5 Region: 556-642
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.21e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 6 Region: 622-698
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.95e-19
Family Cold shock DNA-binding domain-like 0.00041
Further Details:      
 
Domain Number 7 Region: 241-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000288
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 264198.Reut_A0957
Sequence length 728
Comment (Ralstonia eutropha JMP134)
Sequence
MSMFNKVVKQFQWGQHTVRMETGEIARQAGGAVIVDVEDTVVLATVVAAKSPKPGQDFFP
LTVDYIEKTYAAGKIPGGFFKREGRPSENETLTSRLIDRPLRPLFPEGFYNDVQVVVHVV
SLNPEIPADIPALIGASAALAVSGIPFNGPVGAARIGYKDGQYLLNPTRSQMATSDLDLV
VAGTERAVLMVESEANQLSEDVMLGAVVYGHEQMQIAINAIHDLVREGGKPEWDWAPAPK
NEALIAKVTEVALPLLQEAYQLRQKSARSQKLKEVSANVTAALAEAGVDADKVEVGNIMF
DLEAKIVRGQILGGEPRIDGRDTRTVRPIEIRSSVLPRAHGSALFTRGETQALVVATLGT
KSDEQIIDALAGEYRDRFMLHYNMPPFATGETGRVGSPKRREIGHGRLAKRALIPVLPKD
DEFAYTIRLVSEITESNGSSSMASVCGGCLALMDAGVPVKAHVAGVAMGLILEGNKFAVL
TDILGDEDHLGDMDFKVAGTDNGITALQMDIKVQGITKEIMQVALAQAKEGRLHILGAMQ
GAMGHARTELSAHAPRMITMKIHPDKIREVIGKGGSTIQALTKETGTTIDIQEDGTITIA
STSTDGMAEAKRRIEGITAEAEVGKIYNGTVLKLLDFGAIVNILPGKDGLLHISEIVNER
VKDIKDWLKEGQQLRVKLIQADEKGRLRLSLKAALAEEGGSISPVNAGEAAPAPAPAAAP
ATPSDQQQ
Download sequence
Identical sequences Q473U7
gi|73540660|ref|YP_295180.1| 264198.Reut_A0957 WP_011297140.1.84135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]