SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264198.Reut_A2210 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264198.Reut_A2210
Domain Number 1 Region: 78-238
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 8.89e-26
Family IF2B-like 0.037
Further Details:      
 
Domain Number 2 Region: 6-65
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000607
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264198.Reut_A2210
Sequence length 259
Comment (Ralstonia eutropha JMP134)
Sequence
MPRMTLNPRQTALLEEVRTQGFASIDALARKFGVTLQTVRRDVNLLAEGGMLARFHGGVR
VEGSTTENIAYRQRQVLNAQGKVRIARAVAKVVPEGCSLILNIGTTVEEIARALMHHRGL
RVITNNLNVANILADNPDCEVIVAGGVLRSRDRGIVGEATVEFIRQFKVDIGLIGISGIE
ADGTLRDYDFREVKVARTIMEHAREVWLAADASKFHRQAMVELAHLSQIDRLFTDEPLVA
PFGQIVADSGVKCVVADQD
Download sequence
Identical sequences Q46Z60
WP_011298366.1.84135 gi|73541897|ref|YP_296417.1| 264198.Reut_A2210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]