SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264198.Reut_A2764 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  264198.Reut_A2764
Domain Number - Region: 20-91
Classification Level Classification E-value
Superfamily POZ domain 0.0126
Family BTB/POZ domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 264198.Reut_A2764
Sequence length 99
Comment (Ralstonia eutropha JMP134)
Sequence
MNPNVREYFIQGITKEGKTFRPSDWAERLCGVMAQFRPEGDTGDPRLTYSPYVRPIFSGN
VKCVVVDVRLREIEPKALDFVLNFARDNNLQLVEACSLE
Download sequence
Identical sequences Q46XK8
gi|73542449|ref|YP_296969.1| 264198.Reut_A2764 372430 WP_011298910.1.84135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]