SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264198.Reut_B3491 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264198.Reut_B3491
Domain Number 1 Region: 80-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.42e-23
Family Glutathione S-transferase (GST), C-terminal domain 0.0058
Further Details:      
 
Domain Number 2 Region: 1-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.52e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264198.Reut_B3491
Sequence length 217
Comment (Ralstonia eutropha JMP134)
Sequence
MLLYAHPFSSYCQKVLIALYENGTPFEFRMLSPEHPDTLAEHAALWPMQRMPVLVDAGRT
VVESTIIIEYLDIHHRGPVQWIPPDPDDALEVRMMDRFFDNYVMTPMQRIVFDYIRAPGQ
RDAAGVADARRLLDRSYQWLDRAMAGREWAAAGAFGLADCAAAPALFYADWVHPIAPALT
NARAYRSRLLARPAFARAVDEARPYRKLFPPGAPDRD
Download sequence
Identical sequences Q46VI5
WP_011299616.1.84135 gi|73537326|ref|YP_297693.1| 264198.Reut_B3491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]