SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264201.pc0198 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264201.pc0198
Domain Number 1 Region: 234-326
Classification Level Classification E-value
Superfamily RNI-like 1.81e-23
Family 28-residue LRR 0.074
Further Details:      
 
Domain Number 2 Region: 153-274
Classification Level Classification E-value
Superfamily RNI-like 4.47e-18
Family 28-residue LRR 0.026
Further Details:      
 
Domain Number 3 Region: 43-118
Classification Level Classification E-value
Superfamily POZ domain 0.00000141
Family BTB/POZ domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 264201.pc0198
Sequence length 329
Comment (Parachlamydia sp UWE25)
Sequence
MANLEETGAPTIQVPDLSSSSEELQLSFQEGTSLNISHSQLAMLREKSLYFKNLWSGNFQ
ETLQHPLALTQKEFTHLLNCVMDANFKVPLEEITSSIQLADYYELTEVVKSLEEQLINGY
KSQRFELFNSYEDNLVELKTLLNFAQQYQLNTLKNYLELTVVSALLNQTSQLTEFEKILN
HFSNEIEAIHFSDNVYLTDAHLLTLKNCKNLKVLQLQACRNLTDVGLAHLAPLEALKHLN
LSECDNLTDAGLAHLTLLIALQYLDLKGCAKLTDAGLARLRPLVALQHLNLKGCDNLTDI
GLAHLRPLVALQHLDLDGCNNLTDAGLAH
Download sequence
Identical sequences Q6MES7
264201.pc0198 gi|46445832|ref|YP_007197.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]