SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264201.pc0600 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264201.pc0600
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 6.93e-29
Family Ribosomal L11/L12e N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 67-138
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 8.11e-22
Family Ribosomal protein L11, C-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264201.pc0600
Sequence length 142
Comment (Parachlamydia sp UWE25)
Sequence
MSKKVVKVIKLQIPAGKANPAPPIGPALGAAGVNIMAFCKEFNAKTQAMAGDVLPTLITV
YHDKSFSFITKKPPVAELLKKAKGIAKGSGVPNRDKVAKITRSEARKIAEEKIQDMNAAD
LEMATNIVLGTARSMGIDLIKE
Download sequence
Identical sequences Q6MDM5
264201.pc0600 gi|46446234|ref|YP_007599.1| WP_011175150.1.2425 WP_011175150.1.47839 WP_011175150.1.72 WP_011175150.1.90613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]