SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264201.pc0643 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264201.pc0643
Domain Number 1 Region: 297-493
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.42e-45
Family Ribonuclease PH domain 1-like 0.000027
Further Details:      
 
Domain Number 2 Region: 3-148
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-43
Family Ribonuclease PH domain 1-like 0.0000625
Further Details:      
 
Domain Number 3 Region: 151-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.75e-25
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 4 Region: 463-561
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.89e-25
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 5 Region: 560-646
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.01e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Domain Number 6 Region: 620-700
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.94e-19
Family Cold shock DNA-binding domain-like 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 264201.pc0643
Sequence length 702
Comment (Parachlamydia sp UWE25)
Sequence
MEYYLMQRETISVPVGAQEIIFETGKIARQAGGAVVVRCGETVVFTTACAAPNADSTTDF
LPLRVDYQEKFSSAGKTLGGFIKREGRPTEKEVLVSRLIDRPIRPMFEEGYYNEVQLLSF
VWSYDGINSPEPLAICGASAALVISDIPLIKPVGAVRIGFIDAQFIVNPTIEQQKQSKLD
LLIAGTEEAVLMIEGFCDFLTEDQVLEAIEIGHRSIKTICQTLEQWRAKVGKPKNRETLR
QLPKELYADVESIANPLLEKALRICEKQKREEALAEVTKAVNDRLMPENEEPKYPAKHIA
YVIKDVSSKMMRQMILNENVRSDGRTSTDIRFIDIEQSLLPRAHGSSLFTRGETQALAVC
TLGGASMAQRFEDLEGEGNNRFYLQYSFPPYSVGEVGRVGAPGRREIGHGKLAERALMAV
IPTKEQFPYTIRLESNITESNGSSSMATVCGGCLALMDAGVAIKRPVAGIAMGLILENER
FIILSDILGIEDALGDMDFKVTGDQNGITAFQMDIKVEGITIEIMRVALKQAKEGRVHIL
NKMLAVCPTYKGEMSRYAPRIETIQIKPSKIAVVIGPGGKQIRAIIEQTGVQIDIDDTGL
VNIAAIDLVSIEKAKAIIHGLTAEIEIGRIYSGKAISIAPFGVFVEILPGKEGLCHISEF
DVNRINSLDEFVKQGDMLMVKVLDINERGQIKLSRKATLQSQ
Download sequence
Identical sequences gi|46446277|ref|YP_007642.1| 264201.pc0643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]