SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264201.pc1719 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264201.pc1719
Domain Number 1 Region: 22-140,208-322
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.88e-57
Family FabD-like 0.00014
Further Details:      
 
Domain Number 2 Region: 147-214
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000000000445
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264201.pc1719
Sequence length 329
Comment (Parachlamydia sp UWE25)
Sequence
MGCFNFDQNNKVKMDKKIYKRISFLFPGQGAQYPGMAKDFVNQFSLAQLTFEEADDILKR
SLSNIVFNGSEEELTLTKNSQLGIYVSSIAILRVVSELYNLKPFVCSGLSLGEYTALTAS
EMLPYQETLPLVRYRSEYMHEACEETKGSMIVVIGLENSVVEEMVNKLNLTNDLWIANFN
CPGQVVLSGTSLGIEAGVAAAKEHGAKRVLPLRVAGAFHSGLMQVAENRLNPFISSTPFQ
KGSSQLVMNVSGDFVDDLELVRTHLSKQITHSVRWEQGIRAIESHDVDLFIEFGPGKTLN
GLNKRIGVKAPTLSIEKVEDLALLDHIIQ
Download sequence
Identical sequences Q6MAF6
gi|46447353|ref|YP_008718.1| 264201.pc1719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]