SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264201.pc1852 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264201.pc1852
Domain Number 1 Region: 195-239
Classification Level Classification E-value
Superfamily LysM domain 0.00000000068
Family LysM domain 0.0055
Further Details:      
 
Domain Number 2 Region: 45-213
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000314
Family Tropomyosin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264201.pc1852
Sequence length 239
Comment (Parachlamydia sp UWE25)
Sequence
MNVKFSFLMGTLIMFPLLNCMSATYPNYSAHSNLPNQQSTRPVLDNNTIRFKNSLADLKH
ELSNHEAEIRIFENKLHNQESSLDQIRQQIVDDLEGQREYTRAMSINLEGKIDTLDKAVN
GLMNDLRQLKNHANDSVNVLAQYKQKLVDVEKILEAQDQHISSLEAALHSLIDVWQARET
ATQEIANKQAINSSKTYKVQPGDSLEKIAKANKTTVKILRECNQLTSDLIVVGQVLKLP
Download sequence
Identical sequences Q6MA23
264201.pc1852 gi|46447486|ref|YP_008851.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]