SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264203.ZMO0942 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264203.ZMO0942
Domain Number 1 Region: 23-344
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.02e-107
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000167
Further Details:      
 
Domain Number 2 Region: 343-501
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-28
Family Glycosyl hydrolases family 32 C-terminal domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 264203.ZMO0942
Sequence length 512
Comment (Zymomonas mobilis ZM4)
Sequence
MESPSYKNLIKAEDAQKKAGKRLLSSEWYPGFHVTPLTGWMNDPNGLIFFKGEYHLFYQY
YPFAPVWGPMHWGHAKSRDLVHWETLPVALAPGDSFDRDGCFSGCAVDNNGVLTLIYTGH
IVLSNDSLDAIREVQCMATSIDGIHFQKEGIVLEKAPMPQVAHFRDPRVWKENNHWFMVV
GYRTDDEKHQGIGHVALYRSENLKDWIFVKTLLGDNSQLPLGKRAFMWECPDFFSLGNRS
VLMFSPQGLKASGYKNRNLFQNGYILGKWQAPQFTPETSFQELDYGHDFYAAQRFEAKDG
RQILIAWFDMWENQKPSQRDGWAGCMTLPRKLDLIDNKIVMTPVREMEILRQSEKIESVV
TLSDAEHPFTMDSPLQEIELIFDLEKSSAYQAGLALRCNGKGQETLLYIDRSQNRIILDR
NRSGQNVKGIRSCPLPNTSKVRLHIFLDRSSIEIFVGDDQTQGLYSISSRIFPDKDSLKG
RLFAIEGYAVFDSFKRWTLQDANLAAFSSDAC
Download sequence
Identical sequences P0DJA7
264203.ZMO0942 gi|56551838|ref|YP_162677.1| WP_011240801.1.33991 WP_011240801.1.34904 WP_011240801.1.4952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]