SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264462.Bd0086 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  264462.Bd0086
Domain Number - Region: 50-91
Classification Level Classification E-value
Superfamily Quinohemoprotein amine dehydrogenase A chain, domain 3 0.0458
Family Quinohemoprotein amine dehydrogenase A chain, domain 3 0.0064
Further Details:      
 
Domain Number - Region: 451-555
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0713
Family Legume lectins 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 264462.Bd0086
Sequence length 692
Comment (Bdellovibrio bacteriovorus)
Sequence
MGLQSHSQVRENKGMKALSFLFLFLSVVVSLSCQHKEKQIPRDIASLQANGGMEGIWFLQ
GTSSTRGPYNGELELRKASDGTFDVVRVVTYINYFFDGLKVQEVWTGKAVATHDSLTISY
DLRQGDFITKLGNQKRDPSDFDAPITVLSRYVVTPNGLATHYADKKVSNYNEWITTRRDL
EAQPLWVNQRQTISAQGPKVPLVVRGVINLFKKDIGYEKDPLVKSYKNRPEYKNENPYIV
FDPTDFQFYRNNKDVIRVTNKIVDDISITEAAVKRNAYAPTLEEKANSYDKNTRDFHINE
AGMVAHAVLDENGRLLNYSFDGDAALWTGMYLGSQAMRYLKTKDSEALDNVKKSLRGLMT
LMEITNDPQQFARTLALYNPAQPVPAKWHRGEGKFQHLIWLEGGNNDMIKGITHGFLWAG
MVLPQSETELWKELRANSRKLIDLQVVNDKSQNRPAALGLAAWLTNDASFKEQYIKYYDK
IKTKVTGYSFDTTFYWHGSADWSGINLGLVGDITDITLADLLGQSKIRDQLRERLMDAWV
TYSPAQRHLQTLVAYGFAYKHGTRGGNFRSESSEAQFNASLNQAAWGLREIPYPRPNLDV
TIDHSLRPDWCMSPIPRLFWKSLKKPEPPVSYFYQGLYNYPVFELQAFTSNFVWKDGAFL
YQDSHRKGVENSGVDYLYGYWLARYIGATNIN
Download sequence
Identical sequences Q6MRJ3
gi|42521731|ref|NP_967111.1| 264462.Bd0086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]