SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264462.Bd1188 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264462.Bd1188
Domain Number 1 Region: 326-450
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.14e-22
Family HD domain 0.04
Further Details:      
 
Domain Number 2 Region: 209-292
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000486
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Weak hits

Sequence:  264462.Bd1188
Domain Number - Region: 31-82
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0275
Family F1F0 ATP synthase subunit B, membrane domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264462.Bd1188
Sequence length 521
Comment (Bdellovibrio bacteriovorus)
Sequence
MEIVISAIIGLLIGGTVVFVIKRLQDNNKKKSARFEAERIVNKANSEAAKIKKESENKAK
DFESRARKNVEQDIHKQKSTLKNKESQLERRLKEVEDQFKQKMEENERYLNSLKDREEKI
AISENRIKDLEKKGEAHIGELKQKLESVAAMSQDEARRQLLTALEDEAKQEAAKKIAQIE
EEANKESEKKAKRILATALSRFASEYTSERTVSVLALPNDEMKGKIIGREGRNIRTLEAH
CGVDLIVDDTPEAVVISGFDPVRRELARRTIEKLMEDGRVHPARIEEVAEKQRNELMKSM
KEEGERHVMELGIPNMHPELVKIIGGLKYRSYQGQNALNQSLEVATIAGLLAAELGVSVK
LARRAGLLHNIGKAIDHTVEGSYAFVGAEAAKKYNESEDVCHAIRAHDEEEKPHSILAWI
VHAAYTLSSSRPGARRPQMDTFIHRLEDLESIGNSFDGVLKTLALQAGKDIRVLVESSRV
TDDQAVMLSRDIARKIEREMPQAGQVKVTVVRETRSVEHAR
Download sequence
Identical sequences Q6MNQ3
WP_011163700.1.10133 WP_011163700.1.54414 gi|42522725|ref|NP_968105.1| 264462.Bd1188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]