SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264730.PSPPH_0892 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264730.PSPPH_0892
Domain Number 1 Region: 21-215
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.02e-58
Family HD domain 0.0000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 264730.PSPPH_0892
Sequence length 219
Comment (Pseudomonas syringae phaseolicola 1448A)
Sequence
MTAASFAPFQDMASLLIPHTHAEKIDGAHDVSHLLRVWKNVCAIRDREGGDARVLIAATL
LHDCVSVEKDSPFRSSASRLAAARARELLTEMGWDEESIAAVAHAIEAHSFSAAITPLTL
EARILQDADRLDSLGMIGVARTFYVSGRMGRQLYEPNDPHASQRPYDDRNFAADHFHTKL
LHLADSFQTDTGTQMAKIRHDRLKRFLDELMEEIGAPQP
Download sequence
Identical sequences A0A1E3Y001 Q48N53
gi|71736109|ref|YP_273168.1| 264730.PSPPH_0892 WP_011167768.1.10739 WP_011167768.1.12791 WP_011167768.1.27185 WP_011167768.1.28195 WP_011167768.1.31015 WP_011167768.1.70455 WP_011167768.1.86037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]