SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264732.Moth_0219 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  264732.Moth_0219
Domain Number - Region: 37-76
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.000392
Family Chicken cartilage matrix protein 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264732.Moth_0219
Sequence length 80
Comment (Moorella thermoacetica ATCC 39073)
Sequence
MVALDGRNYLLLALLLLTLGLGLAGGARAGAAAAGSQEDPVVTRSYVQEAVDNRLEPLRQ
QLDAASKRLAALQQRLDSLK
Download sequence
Identical sequences Q2RLY5
264732.Moth_0219 WP_011391763.1.11833 WP_011391763.1.17212 WP_011391763.1.24029 WP_011391763.1.46409 WP_011391763.1.52901 WP_011391763.1.79026 WP_011391763.1.90723 YP_429097.1.14147 gi|83589088|ref|YP_429097.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]