SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264732.Moth_0478 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264732.Moth_0478
Domain Number 1 Region: 76-236
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.4e-30
Family IF2B-like 0.035
Further Details:      
 
Domain Number 2 Region: 5-57
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000534
Family Iron-dependent repressor protein 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 264732.Moth_0478
Sequence length 254
Comment (Moorella thermoacetica ATCC 39073)
Sequence
MLAAQRREEIRNALQQKGWLSVTELAQIVGASPATVRRDLKELERAGVLIRTRGGTCLAD
RLPEEMTEHVRAQKNSMEKKKIGQVAAKLVENAGSIILDAGTTTLEVARALKPAQPLRVI
TDSVEIAYELRDRENIVVIVTGGVMRPHAYNLFGGMGEQMLAGMHAQICVMGCSALSLEE
GLTKHDIESMPIRRKMVEISRQLIAVVDSSKFGKTGLVSICPVTRISTLITDSGIDPVFR
SALESAGVQVIVAE
Download sequence
Identical sequences A0A1D7X7T5 Q2RL81
gi|83589342|ref|YP_429351.1| WP_011392015.1.11833 WP_011392015.1.24029 WP_011392015.1.35666 WP_011392015.1.46409 WP_011392015.1.52901 WP_011392015.1.64341 WP_011392015.1.79026 WP_011392015.1.90723 YP_429351.1.14147 MtR54 264732.Moth_0478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]